(data stored in ACNUC7421 zone)

EMBL: CP001600.PE307

CP001600.PE307       Location/Qualifiers
FT   CDS_pept        338708..340561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0336"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67578"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX2"
FT                   /protein_id="ACR67578.1"
FT                   /translation="MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGR
FT                   LYLAARWLEMKTEHSAPGLGKLLRTDSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALL
FT                   ERVGHTIVYGTTRVGKTRLAELLVTQDIRRGEVTIVFDPKGDADLMKRVWAEAHRADRG
FT                   DALYIFHLGWPEISARYNAVGRFGRVSEVASRVAGQLSGEGNSAAFREFAWRFVNIIAR
FT                   ALVALGERPDYTLIMRYVNNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPRN
FT                   MQGQPDAVRIWSIEVALSSEEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLT
FT                   TGKTAELLAPDYLEMSDSRPIFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLV
FT                   SVAGHIYKHGIHAGLPGEGESKVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQ
FT                   TSSDIEARIGNAAKTAQVQGNFNNLIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQD
FT                   TDISAGQDFTSSTQDRVGTVKVPLLEPADVVTLPKGQAFALLEGGQLWKIRMPLPADDA
FT                   DDTLMPQSIAKIAEEMRRNYHSGEAWWNDAPGIVPAGGVRG"
     atgagcgccg ggcagatacc ggtcagtggt cagcgcctgt ttttggggcg cgggtttcgc        60
     tggacacaaa aacataccca gcgactgcag gatacgctgc gcccggaagt ggcgaagtac       120
     ctgcagccgg gtcggctata tctggccgct cgctggctgg aaatgaagac ggagcattca       180
     gcgccgggtc tgggaaaact gctgcgcacg gattcgcccc tgaacccggt tcgcccgctg       240
     ccgccggttg gtggtaatcc ggtgctgcac ggcatagagc cggatgagca ggatgtctgg       300
     ctggcgttgc tggagcgtgt cgggcatacc atcgtctatg gcaccacccg tgtgggaaaa       360
     acacgcctgg cggagctgct ggttacccag gatattcgtc gcggtgaagt caccattgtt       420
     tttgatccga agggcgatgc cgatctgatg aagcgcgtct gggctgaagc acaccgtgcc       480
     gacagggggg atgcgctgta tattttccat ctgggctggc ctgaaatctc cgcccgctat       540
     aacgctgtcg gacgttttgg ccgggtgtca gaagtggcgt cccgcgtggc gggccaactg       600
     tcgggggagg ggaacagcgc ggcgttccgt gagtttgcct ggcggtttgt caacattatc       660
     gcccgggccc tggtagcact gggtgagcgt ccggattaca cgctgattat gcggtatgtg       720
     aacaatatcg ccgatctgta tatccgttat gcagagaagg ttatccgtga gcagcttccc       780
     tcactgcagg cacaaattca gaataacgag caggttctgg gggatgacga tgttccacgg       840
     aatatgcagg ggcagccgga tgcggtgcgc atatggtcca tagaggtggc gctcagctcg       900
     gaagagggaa agcagctgta tgatcccatt ctggatggtc tgcgtagcgc agtacgctat       960
     gaccgtacct attttgataa aattgtggcc tccctgctgc ctctgctgga gaaactgaca      1020
     accgggaaaa ccgcagagtt gctggcgccg gattatctgg agatgagcga ttcacggccg      1080
     atttttgact gggagcagat aatccgcaaa aaggcagtgg tgtatattgg ccttgatgca      1140
     ctcagcgaca gtgaagtggc cagcgccgtg gggaattcca tgttcgccga tctggtgagc      1200
     gtggccggtc atatctacaa gcatggtatt catgccggac tgccgggaga gggtgagagc      1260
     aaggttccgg ttaacctgca ttgtgatgaa tttaatgagt tgatgggtga tgaatttatc      1320
     ccgcttatta acaaaggggg cggcgccggt atgcaggtaa ccgcttatac ccagacctca      1380
     tcggatattg aggcccggat cggtaatgcg gccaaaacgg ctcaggtcca gggcaacttc      1440
     aacaatctga ttatgttacg tgtcagggag aaccgtaccg ctgagctcct gactacgcaa      1500
     ttgccgcagg tagagattta caccaagacg ctggtctctg gccatcagga taccgatatc      1560
     agtgcgggtc aggattttac ctccagtacg caggatcgtg tcgggacggt caaagtaccg      1620
     ttgctagagc cggctgatgt ggtaacacta ccgaaagggc aggcgttcgc cctgctggaa      1680
     ggcgggcaac tgtggaaaat ccgtatgccg ctgcctgccg acgatgcgga tgatacactg      1740
     atgccgcaga gcattgcgaa aattgccgag gaaatgcgcc gcaattacca cagtggtgag      1800
     gcgtggtgga atgatgcgcc gggcatcgtg cctgcaggag gtgtgcgtgg ctga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page