(data stored in ACNUC7421 zone)

EMBL: CP001600.PE308

CP001600.PE308       Location/Qualifiers
FT   CDS_pept        340554..341309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0337"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67579"
FT                   /db_xref="GOA:C5BCX3"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX3"
FT                   /protein_id="ACR67579.1"
FT                   /translation="MAELQRNGPPQPRPEKPHDLLYNVFWGWPWALIGMLLGSLMLSLL
FT                   IEYTGIAFFWPEAGAAHSEAVMNTELGWLSTEFTRSLLLSEPSVTVSRWVTTAYQWLFV
FT                   DSGFTGWIKQHVLQTGSGNELTRNLSSWSGWLAGYLHEYLTATVWICVITLVRVTILVL
FT                   SVPLFLMVVLVALVEGLGRRDLRRYGAGYESSFVYHHAKKRVKPAIVVPIILYLSWPTA
FT                   VYPNLLLLPAAILLGVAITVTMASFKKYL"
     gtggctgaac ttcagcgtaa tggtccgcct cagccccggc cggagaagcc acatgatctg        60
     ctttataatg tgttctgggg ctggccctgg gcgctgatcg gcatgctgct gggttcgctg       120
     atgctgagcc tgctgattga gtacaccggc attgcgttct tctggccgga agcgggtgca       180
     gcccacagcg aggcggtgat gaataccgaa ctgggctggc tgtcgacaga attcacccgc       240
     agcctgttgc tgtcggagcc ttctgtgact gtttcccggt gggtaacaac tgcgtatcag       300
     tggctgtttg ttgacagtgg gtttactggc tggataaagc agcatgtgct gcagacgggc       360
     agcggtaacg agctgacccg taatctgagc agctggagtg ggtggcttgc gggctatctg       420
     catgaatatc tgacggcgac cgtgtggata tgcgtgatta ccctggtgcg ggtgaccata       480
     ctggttctgt cagtcccact gtttctgatg gttgtactgg ttgcgttggt tgaaggactg       540
     gggcgcaggg atctgcggcg ctatggggcg ggttatgaaa gctcgtttgt ttatcatcat       600
     gctaaaaaga gggtgaaacc agcgatagtg gtgcccataa tactgtatct ttcctggccg       660
     acggcggtgt accctaacct gctgttgtta cctgctgcta tattactggg tgtcgccatc       720
     acggtcacca tggcttcatt caagaaatat ctttag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page