(data stored in ACNUC7421 zone)

EMBL: CP001600.PE309

CP001600.PE309       Location/Qualifiers
FT   CDS_pept        complement(341417..341881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0338"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67580"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX4"
FT                   /protein_id="ACR67580.1"
FT                   /translation="MANIAARARAVVIKGTELAHFENEVFSWHRINNQNGDEILPAVLI
FT                   TNAHPDYFMENSHGYKRETGLYRESKNNELKLILIPLKKFCPTTSDAISLIEKVFSDIK
FT                   EGKDLSDFRIAKKAQKGIGSAIVDSIILEPNIGGIGFKLNQLLSFLRKDK"
     atggctaata ttgctgccag agcaagagcc gttgtaatca aggggacaga attagctcat        60
     tttgaaaatg aagtattttc ctggcaccga attaataatc aaaatggtga tgaaatcctc       120
     ccggcagtgc ttattacaaa cgctcaccca gactatttta tggaaaatag tcacgggtac       180
     aaacgtgaaa caggtttgta tcgggaatca aagaataatg agctaaaact tatactcatt       240
     cctttaaaaa aattctgccc gactacatct gatgctatct cccttataga aaaagtattt       300
     tctgatatta aggagggcaa ggatctttcc gatttcagaa ttgcaaaaaa agcacagaaa       360
     ggcatcggtt cagctatcgt tgattctatt attctagagc caaatattgg tggtattggt       420
     ttcaaattaa accaattact tagcttcttg cgaaaggata aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page