(data stored in ACNUC7421 zone)

EMBL: CP001600.PE310

CP001600.PE310       Location/Qualifiers
FT   CDS_pept        342113..342454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0339"
FT                   /product="conserved hypothetical protein, RAQPRD motiff
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67581"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX5"
FT                   /protein_id="ACR67581.1"
FT                   /translation="MNHPHPVRSLSARIPGITGLLLLATLSTTVQAAEKDELASALRQL
FT                   DQVQASLERARVAAAQAAPAEQGRFFFDYRQATSDLNTIRIGIDRYLEPSRSQPRASFV
FT                   SGNYRRERP"
     atgaaccatc ctcatccggt ccggagcctg agcgctcgta tcccgggcat caccggcctg        60
     ctactgttgg ccacattgtc cacgacggta caagcggcag aaaaagacga gctcgcttcg       120
     gccttgcgcc aactggatca agtgcaagcc tcacttgaac gtgcccgcgt agcggcggct       180
     caggccgctc ctgctgagca ggggcgtttc ttttttgact accgtcaggc tacatccgat       240
     ctgaatacca ttcgtatcgg tattgaccgc tatctggagc catcccggtc ccaaccacgg       300
     gcttcatttg ttagcggtaa ttatcgtcgg gagcgtccct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page