(data stored in ACNUC7421 zone)

EMBL: CP001600.PE312

CP001600.PE312       Location/Qualifiers
FT   CDS_pept        342723..343109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0341"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67583"
FT                   /db_xref="GOA:C5BCX7"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX7"
FT                   /protein_id="ACR67583.1"
FT                   /translation="MHHSASVATHLRRDIDHVINRTFTWALLVWLICKPAFADLPTVEA
FT                   PTSNGGSGLMGQIKGYLQDGVVIGGLVVAAIAFINVAIAAVHTFTEVRNEKSTWTKFGS
FT                   IIVVGVVLLVAVLWLLGKSADIIL"
     atgcatcact ctgcgtctgt tgctacccac ctgcgtcgtg atattgacca cgtcattaac        60
     cgtactttca cgtgggcgtt gctggtctgg ctgatctgta aacccgcatt cgctgacctg       120
     ccaaccgtcg aagcgccaac atccaatggg ggatctggcc tgatggggca gatcaaaggc       180
     tatctgcagg atggtgtcgt tattggtgga ctggtggtgg cagccattgc gtttattaac       240
     gtagcgattg ctgcagtaca tacctttacc gaggtccgga atgagaagtc cacctggacg       300
     aagtttggct ccatcatcgt ggtgggagtg gtgttactgg ttgctgtcct ctggctgttg       360
     ggcaagtccg ccgacattat tctctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page