(data stored in ACNUC7421 zone)

EMBL: CP001600.PE313

CP001600.PE313       Location/Qualifiers
FT   CDS_pept        343119..343475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0342"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67584"
FT                   /db_xref="GOA:C5BCX8"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX8"
FT                   /protein_id="ACR67584.1"
FT                   /translation="MQTIRFLPDRLNSEPVVFRGFTTPEMGLASLAGLGVGLLLSLPFI
FT                   PLAGWVIIPTGMLLAPLLVIGFGGRWLSRIKRGKPENYIWQRLEAFKRRHSLGNPTLII
FT                   DARGWSLKRTGREK"
     atgcagacca ttcgcttttt acctgaccgt ctgaacagtg aacctgtggt atttcgcggg        60
     ttcaccaccc cggagatggg gcttgcttcc ctggccggtc tgggtgtggg tctgctcctg       120
     tctttgccat ttatccctct tgccggctgg gtcattatcc cgaccggtat gctactggca       180
     ccgctactgg ttatcggttt cggcggtcgg tggctgagcc gcatcaaacg cggcaagccc       240
     gaaaactata tctggcagcg actggaggcg ttcaaacgtc gtcacagcct gggcaacccg       300
     actctgatca ttgatgcccg gggatggtcc ctgaaacgaa ccgggagaga aaaatga          357
//

If you have problems or comments...

PBIL Back to PBIL home page