(data stored in ACNUC7421 zone)

EMBL: CP001600.PE314

CP001600.PE314       Location/Qualifiers
FT   CDS_pept        343472..344131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0343"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67585"
FT                   /db_xref="GOA:C5BCX9"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:C5BCX9"
FT                   /protein_id="ACR67585.1"
FT                   /translation="MSRFRHAVKDRDQHILTLRIVCGVLAFFLLITCAGWMLAPNKLTV
FT                   HNPPDLRAGSTRPWWEVPASSVYSFAFYIFQQLNAWPKNGEVDYPAKIHALSAYLTPGC
FT                   QDYLNTEARKRSNTGQLTDRVRVVYEIPGRGYQSKSVSVISRDNWVVRLDLVADEYFHA
FT                   EPVKRALVRYPLKVVRWEGDAERNPFGLALDCYDGVPQRLEAALPTEIPAKPGVFQ"
     atgagccgtt ttcgtcatgc ggtcaaagac cgggatcagc atattctgac actgcgtatt        60
     gtctgcggtg tgctggcctt tttcctgtta atcacctgtg ccggctggat gttggcccca       120
     aataaactga ccgtccataa cccgccggat ttacgtgccg gaagcacccg cccctggtgg       180
     gaagtaccgg catcgtcggt ctactccttc gccttctata ttttccagca acttaatgcc       240
     tggcctaaaa atggtgaagt ggattatccg gcaaaaattc atgcgttgtc agcctatctg       300
     acccccggtt gccaggacta tctgaatacc gaggccagga aaagaagcaa cactggtcag       360
     ctgactgacc gtgttcgtgt ggtgtatgaa attcccggtc gtggctatca gtcgaagagc       420
     gtcagcgtta tcagcagaga taactgggtg gtacgtctcg acctggtggc ggatgagtat       480
     tttcatgctg aaccggtaaa gcgtgccttg gtccgctatc cactaaaagt ggtgcgctgg       540
     gagggggatg ctgaacgcaa tccgtttggt ctggcgctgg actgttatga cggtgtgccg       600
     cagcgtctgg aggcggcact gccaacggaa attcccgcga aaccaggagt gtttcagtaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page