(data stored in ACNUC7421 zone)

EMBL: CP001600.PE317

CP001600.PE317       Location/Qualifiers
FT   CDS_pept        346754..346996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0346"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67588"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH2"
FT                   /protein_id="ACR67588.1"
FT                   /translation="MRRPLTDNEQRKGTQDDRSYSRTQESEISQQFSRLPNPDMVMYLY
FT                   SHLAGGNTPVPGYSTVFPFYSQTQYAMPGERTEAL"
     ttgcgccgcc cgttaactga caatgaacag cggaaaggta cacaggacga tcgcagctac        60
     agccgcacgc aggagagtga aatttcacaa cagttctctc gtttgcccaa tcccgacatg       120
     gtgatgtacc tgtattccca tctggctggc ggcaacacac cagtgcctgg ctacagcaca       180
     gtatttcctt tctacagcca gacgcagtat gcgatgcctg gtgaacgtac ggaggcgctg       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page