(data stored in ACNUC7421 zone)

EMBL: CP001600.PE318

CP001600.PE318       Location/Qualifiers
FT   CDS_pept        346996..349860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0347"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67589"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH3"
FT                   /protein_id="ACR67589.1"
FT                   /translation="MFSLFGRKNEVKPDGTAGQPEGEVSPLVIHGREPLTRPGRMTRQE
FT                   EAKVYHANPSIIDYLPWVEFLDEDQCLLLEDGISVGAVYDVKPVATEGRTNDRLEQIRD
FT                   TVEDALQDSFDEYDENPWVVQFFCQDEDDAEAYLDHLRGYVKPHAQRTAFTEAWLGEMA
FT                   RHIRSISRPEGLFTDALITGQLWRGQQRRTRMVIYRWSGKSASRDPMPPVAMLNQACER
FT                   VVSALGGAGIRCTRQNGLQVHSWLLRLFNPSPDWVDKSTLYRQAAYADPRDFPAGVAPV
FT                   SNDFAETLWFTPPVSDPENGVWWIDNKLHCALPVERLRTPPEPGTITGEQARGEKKINA
FT                   LMDMFPEGTLLCMTIVVQPQDRLEEQFNRLSKNAVGENTESGRVRQDVKTVKEYLGNRH
FT                   KLYRAGITFLLRGDDMDNLKRKRLDLTTVLLGAGLQPVRSEFEVGPLNTWLRALPMCFN
FT                   PNSDKKHWYTRLTWVQHLAGLLPVTGRETGTGNPGFSFFNRGGDILTFDPLNKYDRTQN
FT                   AHLLLFGPTGAGKSATLCYAFSQLMAVHRPRLFIAEAGNSFGLQADYFESLGLSVNKIS
FT                   VKPGSGVSLPPFADAHKLVEEGLAAHAVDESDLPDIDADSDGEGEDEDKRDILGEMEIS
FT                   ARMMITGGDPKEEAEMKRADRAMIREALLMAAHATYKEGRQMLPSDLQKALYSIAGDDS
FT                   DEGQNVRNAQRKAKAAEMAEALGMFTQEGSFEAELFNREGELWPEADVTLVDLGHLARE
FT                   GYEAQMALTMVSMTNMINNIAERDQYLGRDIVFAVDEAHIVTVNPLLSPYMTKVVKMWR
FT                   KLGAWLWLATQNLKDFPDIAEKMLNMAEWWICLTMPPEEVKDISRFRALTPEQEAVLLS
FT                   ARKLSGCYTEGVVLAKRIEALFRAVPPSLYLALGMTEKEEKAERRALMREHHCSELDAA
FT                   KLIARKLDRLRGLTDAHDEESTAA"
     atgttttctc ttttcggccg taaaaatgaa gtgaaacccg atggcacggc agggcagcca        60
     gagggggagg tctctcctct ggttattcac ggccgggagc cactgacgcg accaggccgg       120
     atgacccggc aggaagaggc aaaagtgtat cacgctaatc cgtccatcat tgattatctg       180
     ccatgggtgg aattcctgga tgaagatcag tgtcttctgc ttgaggacgg tatctccgtc       240
     ggtgccgttt atgacgtgaa gccagtagcc acggaagggc gcacaaatga tcgtctggag       300
     cagatccgcg atacggtgga agatgccctg caggacagct ttgatgaata tgatgagaat       360
     ccctgggtgg tgcagttctt ctgccaggat gaagatgatg ctgaagcgta tctggaccac       420
     ttacgcggct acgtgaaacc gcatgcgcag cgcacggcat ttacggaggc ttggctgggt       480
     gaaatggcac gtcatatccg cagtatctcg cggccggagg ggctgtttac cgatgcgttg       540
     atcaccggtc agctgtggcg cggccagcag cgtcgcaccc gtatggttat ttatcgctgg       600
     agcgggaagt ccgcttcccg ggacccgatg ccgccggtag cgatgctcaa ccaggcgtgt       660
     gaacgtgtgg tcagtgcgct gggcggggcc ggtattcgtt gtacccgtca gaatggcctg       720
     caggtgcaca gctggctgct gcgcctgttt aatccgtctc cggactgggt ggataaatcc       780
     acactctatc gtcaggcggc gtatgccgat ccgcgcgact tcccggcggg cgtggcacca       840
     gtcagcaatg attttgctga aacgctgtgg tttacgccac ccgtttcgga tccggagaac       900
     ggcgtatggt ggatagataa taaactacat tgtgctctgc cggttgagag actgcgtacc       960
     ccgccggagc caggtaccat caccggtgaa caggcccgcg gtgagaaaaa aatcaacgca      1020
     ctgatggata tgtttccaga agggacactg ctgtgcatga cgattgttgt gcagccgcag      1080
     gacaggctgg aagaacagtt caaccgcctg tcgaaaaatg ccgtcgggga gaataccgaa      1140
     tccggccgtg tccgtcagga tgtgaaaacg gtgaaagagt atctgggaaa ccggcataag      1200
     ctgtatcgtg ccgggatcac cttccttctg cgcggtgatg atatggataa tcttaagcgc      1260
     aaacgtcttg atttgaccac cgtattgctt ggggccggcc tgcagccggt tcgatcggaa      1320
     tttgaggtgg ggccgctgaa tacctggctg cgggcgctgc caatgtgctt taacccgaac      1380
     agcgataaaa aacattggta cacccgcctg acctgggtac agcacctggc agggttgcta      1440
     ccggttaccg ggcgggaaac cggtaccggc aacccgggtt tcagcttttt taaccgcggc      1500
     ggtgatattc tgacgtttga tccactgaac aagtatgacc gtacccagaa tgcgcatctg      1560
     ttgttgttcg gaccgacggg ggcaggtaaa tcagccacgc tgtgttatgc cttttctcaa      1620
     ctgatggcgg ttcaccggcc acgtctgttt atcgctgaag ctgggaacag ttttggcctg      1680
     caggctgatt attttgaaag ccttggactt tctgtcaaca agataagcgt caaaccgggt      1740
     agtggggtca gcctgccgcc gtttgccgac gcgcataaac tggtcgaaga agggctggca      1800
     gcacatgccg ttgatgagag cgatctcccc gatatcgatg ccgacagtga cggagagggt      1860
     gaagacgagg ataagcggga tattctcggt gagatggaga tttcagcccg catgatgata      1920
     acgggcggcg atccgaaaga agaagccgaa atgaagcgtg ccgaccgggc tatgatccgt      1980
     gaagcgctgc tgatggccgc gcatgcaaca tataaagaag ggaggcagat gctgccttct      2040
     gacctgcaga aagcgttata cagcattgcc ggtgatgaca gcgatgaggg gcagaatgtc      2100
     cgtaatgccc agcgtaaggc gaaagccgca gagatggcgg aggcgctggg gatgttcact      2160
     caggaaggca gctttgaggc ggagctgttc aaccgcgagg gggaattgtg gcctgaagcg      2220
     gatgtgaccc tggtggatct cggtcatctg gcgcgtgagg gttatgaagc gcagatggcg      2280
     ctgaccatgg tgtcaatgac caacatgatt aacaatattg cagagcggga tcagtatctc      2340
     ggccgcgata tagtcttcgc ggtggatgag gcgcatattg tgacggttaa tccactgctg      2400
     tcgccgtata tgaccaaagt ggtcaaaatg tggcgaaagt taggggcctg gctgtggctg      2460
     gccacgcaga acctgaagga cttcccggat attgcggaga aaatgctgaa catggcggag      2520
     tggtggattt gcctcaccat gccaccggaa gaggtgaaag acatcagccg gttccgtgca      2580
     ctcacgcctg aacaggaagc cgtgctgctt tccgcccgta agctgtcagg ttgctataca      2640
     gaaggggtgg tgctggccaa acgtattgag gcgctgttcc gtgctgttcc ccccagtctg      2700
     tatcttgcgc tgggcatgac ggagaaagag gaaaaggcgg aacgccgggc gctgatgcgt      2760
     gagcatcact gtagcgaact ggacgcggcg aagctgattg cccgtaaact ggaccggttg      2820
     cgcggactga ctgacgcaca cgacgaggag agcactgcag catga                      2865
//

If you have problems or comments...

PBIL Back to PBIL home page