(data stored in ACNUC7421 zone)

EMBL: CP001600.PE319

CP001600.PE319       Location/Qualifiers
FT   CDS_pept        349857..350249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0348"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67590"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH4"
FT                   /protein_id="ACR67590.1"
FT                   /translation="MMTLKYPVPCVCGNDSPDNTVFTLPPQGEPGMSVVTQANLQRLSE
FT                   HIRQRLNGPVTVTCHPHRVGLSSCVAVTVEGRLRRAVNILITVSGQGSWPAEEEYEHPR
FT                   WYITVTDAADMVYLVLWLNNGVCQEL"
     atgatgacgc tgaagtatcc ggtaccctgt gtctgcggta atgacagccc ggataacact        60
     gttttcaccc tgccaccgca gggtgaaccc gggatgtctg tggtgacgca ggctaatctg       120
     caacgtctga gcgaacacat ccgacagcga ctgaatggcc cggtgactgt tacctgtcac       180
     cctcaccggg tagggctgag cagctgtgtg gcggttacgg tggagggcag actccgcaga       240
     gcggttaata ttcttatcac cgttagtggg cagggaagct ggccagcaga ggaagagtat       300
     gaacatcccc gctggtatat taccgtgacg gatgcggccg atatggttta cttggtcctt       360
     tggctcaata acggagtgtg tcaagagctg tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page