(data stored in ACNUC7421 zone)

EMBL: CP001600.PE32

CP001600.PE32        Location/Qualifiers
FT   CDS_pept        complement(31096..31719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0034"
FT                   /product="guanylate kinase, putative"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67294"
FT                   /db_xref="GOA:C5B9B4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B4"
FT                   /protein_id="ACR67294.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQTLLKTQPTYDSRVSVSHTTRASR
FT                   PGEQHGEHYYFVSVDEFKAMIARDDFLEHAEVFGNYYGTSRQAIEKVLAQGIDVFLDID
FT                   WQGARQVRSKMPQARSIFILPPSREELARRLHGRGQDSDDVIAGRMAKAVSEISHYSEY
FT                   DYLIINDDFDVALQDLRTIIRAERLRRERQQLRHDALISKLLAD"
     atggtacaag gtacgctcta tatcgtttcc gcgccgagcg gcgctggtaa atccagcctg        60
     atccagactc tgctgaaaac gcagccgacc tacgattccc gggtttccgt ctcgcacacc       120
     acgcgcgcca gccgtccggg cgaacagcac ggtgagcatt actactttgt ctctgtggac       180
     gagttcaagg cgatgatcgc ccgcgatgat ttcctggagc acgccgaagt ctttggcaac       240
     tactatggca cctcgcgtca ggcgatcgaa aaggttctgg cgcaggggat cgatgttttc       300
     ctcgatatcg actggcaggg cgcccgccag gtacgcagca aaatgccgca ggcccgcagc       360
     atcttcattc tgccgccgtc gcgcgaggag ctggcgcgcc gtctgcacgg ccgtggccag       420
     gacagcgatg acgtcatcgc cgggcgtatg gccaaggcgg tcagcgaaat atcgcactat       480
     agcgagtacg actaccttat catcaacgac gacttcgacg tcgcgctcca ggatctgcgc       540
     accatcatcc gcgccgaacg cctgcgccgc gagcgtcagc agctgcgtca tgatgcttta       600
     atcagcaaat tattggcaga ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page