(data stored in ACNUC7421 zone)

EMBL: CP001600.PE324

CP001600.PE324       Location/Qualifiers
FT   CDS_pept        355670..356662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0353"
FT                   /product="Protein of unknown function (DUF1527)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67595"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDH9"
FT                   /protein_id="ACR67595.1"
FT                   /translation="MNQPPSWFRRTLCSAAVATVLGTASIPTALAALNTAQIVASAVTQ
FT                   DCISWRVSGICYWLFCSWYGCTVRTSVKVTHFIPQTVVSTYVAPGGNPWTEMAAVSQTA
FT                   GGLENAVTGALSGVTAGGANPADMKNPGQRKSNIRFKYADAIGHPATSLIGGRIPGYSC
FT                   DSAATPLMPYFLSTLDSIAWRTGVPESLYPEALVIGRREIGSQASGNMWGNVYPRSGFV
FT                   SQSDDDKASAVVAQRVADIITRTGQPHVYHELKGPRRDGYWPPGEVTENTGSKNHKWQR
FT                   LAPSMTRSCAVFPDGSHSAASDNNAAFALWQPYSCCKRMGQKFLGSTDF"
     gtgaatcagc ctccctcttg gttcaggaga acgctttgct ctgccgctgt cgccaccgtt        60
     ttgggtactg cgtcaatacc taccgcgctc gctgcactga ataccgcgca aatcgtggct       120
     agtgcggtga cgcaggattg catcagctgg cgggtaagcg gtatctgcta ctggctgttc       180
     tgttcctggt atggttgtac ggtacgtacc tctgtgaaag tgactcactt tattcctcag       240
     acggtggttt cgacttatgt cgcgcctgga ggaaatcctt ggacagagat ggctgctgtc       300
     agtcagacag cgggcgggtt agagaatgct gttactggcg cgttgtctgg agtgacggcc       360
     ggtggcgcca atccggcaga catgaagaat ccggggcagc gtaaatccaa tattcgtttc       420
     aaatatgcgg atgctattgg tcatccggcc acatcgctta tcgggggccg tatcccaggg       480
     tattcctgtg atagcgcagc tacacctctg atgccgtatt tcctcagtac gttggattcc       540
     attgcctggc gaacgggcgt accggaatcg ttgtatcccg aagcgctggt cattggccga       600
     cgagaaattg gcagtcaggc atctggcaac atgtggggca atgtttatcc acgctccggg       660
     tttgttagcc agagcgatga tgacaaagca tcggcggtag tagcgcaacg tgttgcagac       720
     atcattactc gcacagggca accacatgtt tatcacgagc tgaaagggcc ccgccgcgat       780
     ggatactggc cgccgggaga agtcacggaa aataccggtt ccaaaaatca taaatggcaa       840
     cgcctggctc caagtatgac acgaagttgc gcggtatttc cggacgggag tcacagcgcg       900
     gccagtgata acaacgcggc ttttgcgttg tggcaaccct acagttgttg caagcgcatg       960
     ggacagaaat tcttgggcag tactgatttt tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page