(data stored in ACNUC7421 zone)

EMBL: CP001600.PE325

CP001600.PE325       Location/Qualifiers
FT   CDS_pept        356809..358107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0354"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67596"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI0"
FT                   /protein_id="ACR67596.1"
FT                   /translation="MDGAVSDKLFYTLGGGSVISQPATRSNMKKLGMDIGWSSDLMCGN
FT                   FDLKTTVGNQLNGVTDGFKNLMGDVIQGATGAVASLPAMLIQRANPGLYDMLTNGVLQA
FT                   NVSFDKAQLNCQNMAKKMMDFSDTSKWTQAAMAEEYKSLVNNGETDAIRADQKYQDADG
FT                   TSGKKWIGGQIRGGKGQKAIRPTYDLVSAGYNMMNSLNVLSSETVSGASCNGGACSKFS
FT                   NAEEAAQAVVRVLGDRSMRTCSNALQCTSGDTDDQPGLSVAGTGFAPMLEEATKNNTEQ
FT                   LVKLVNGTVKPTATELAKLKTGGLPVTANVIRALQRDPDNTALTVRLASELAMSDAVET
FT                   ALLMRRMLTTGMSEPNAQDQPLALEDGVHRIDALDREIMALKNEMDLKRELARNSVLTI
FT                   IERDNERVGTNPMIQQTDNADSRFQKLDTPDAE"
     gtggatggcg ctgtctccga caagttgttt tataccttgg gcggtgggtc ggtgatatcg        60
     cagccggcga cgcgcagcaa tatgaaaaaa ctgggaatgg atattgggtg gagcagtgac       120
     ctgatgtgcg gcaacttcga ccttaaaacc actgttggca atcagctgaa tggggtgaca       180
     gacggattta agaatcttat gggcgacgtt atccaggggg ctaccggtgc ggtcgccagc       240
     ctgccggcga tgcttattca gcgggccaat ccgggcctgt atgacatgct gaccaatggg       300
     gtgctgcagg caaatgtgtc cttcgacaag gcgcaactga actgtcagaa catggcgaag       360
     aaaatgatgg atttcagtga taccagcaag tggacccagg cagctatggc ggaagagtat       420
     aaatcgctgg tcaacaatgg agaaacagac gcaatacgtg cggatcaaaa atatcaggat       480
     gctgacggaa cctccgggaa aaaatggatt ggtggtcaga ttagaggagg aaaagggcag       540
     aaagcgatcc ggccgacata tgatttagta tctgcaggtt acaacatgat gaatagtctt       600
     aacgtactaa gttcagaaac tgtgagtggt gccagttgta acggtggtgc ctgcagtaag       660
     ttcagtaatg ctgaagaagc tgcacaagct gtggtgagag ttcttggtga tcgctcaatg       720
     cgcacctgta gcaatgcgtt gcagtgtacc agtggcgata ccgacgatca gcccggcctg       780
     tccgtcgctg gcaccggatt tgcgccgatg ctggaagaag ccacaaagaa caatacggag       840
     caactggtga aactggtcaa tggtaccgta aaacccacag ctactgaact ggcgaaactg       900
     aaaacgggtg ggttgccggt aacggccaat gtcattaggg ctctgcaacg agatccggat       960
     aatactgcgc tgaccgttcg tcttgccagt gagcttgcca tgtctgatgc ggtcgaaact      1020
     gcactattga tgcgtcggat gctgacaaca ggtatgagtg agccaaatgc ccaggatcaa      1080
     ccgctcgcgc tggaagatgg tgttcaccgg atcgatgctc tcgatcgcga aattatggca      1140
     ttgaagaatg aaatggacct gaagcgtgag ctggcgagga actcggtact gaccatcatt      1200
     gaacgggaca acgaacgtgt cggtacaaac ccaatgattc agcagacgga caatgccgac      1260
     agccggttcc agaagctcga tacccctgat gcagagtaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page