(data stored in ACNUC7421 zone)

EMBL: CP001600.PE326

CP001600.PE326       Location/Qualifiers
FT   CDS_pept        358121..358474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0355"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67597"
FT                   /db_xref="GOA:C5BDI1"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI1"
FT                   /protein_id="ACR67597.1"
FT                   /translation="MKNSHRDLLCKTGKGLKAGLLYLLILALMMAVGLWLADTGMRHPE
FT                   SVASLKRWMHATRYGWLVWRLVIYSAVGWGLWKIWHAPGFRPEYRRSLLRIAGASTLFF
FT                   LVCEYSIFSGVGG"
     atgaaaaaca gtcaccgcga cctgctgtgt aaaacgggaa aaggtttaaa agctgggctg        60
     ctttatctac tgattctagc gctgatgatg gcagtaggac tttggctggc cgatacaggt       120
     atgcgtcatc cggagagcgt ggcatccctg aaacgatgga tgcatgcaac gcgttacggt       180
     tggttggtat ggcggttggt tatttacagt gctgtcggat gggggctgtg gaaaatctgg       240
     catgcgccgg gctttcgtcc ggaatatcgt cggtcactgt tgcgtatcgc cggcgccagc       300
     acattattct ttctggtctg tgagtactcc attttttccg gcgtgggagg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page