(data stored in ACNUC7421 zone)

EMBL: CP001600.PE327

CP001600.PE327       Location/Qualifiers
FT   CDS_pept        358481..360016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0356"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67598"
FT                   /db_xref="GOA:C5BDI2"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI2"
FT                   /protein_id="ACR67598.1"
FT                   /translation="MTTNSYLEYFLTLLGWLVNNGLWDVLVSTGLFALPLAFKVASIWL
FT                   KVREEGEDEGNKGMLSLPRIENALYGAFFVMIACCVPLIQVSLSTLEFDKSRGKTCGTW
FT                   TPKAPNETGYSGIISSMDGESAAAPVWWVLVHKLSKGVTQAAVASIPCRPDLRQLRFEV
FT                   QRTFIENRALADELQDFTNDCYSLALYQWKRRDQGQTTDKATLSDLSWIGSSTFLKGDY
FT                   TTLQSKLPRGMFSWSDARDSGRPNTGNGGYPYCSEWWSAADTGLKARVMKQVDDSYWLR
FT                   LSAAMKMIGSSQTDYQEEVIRRLVSPANLTVSHGGEVYNGYGGNAGMTAMNAISRVAGT
FT                   AGASVASLGAFPALDAMRQALPMVQAVILMAIYIMVPLILTFAAYEFKTVITLTLVIFA
FT                   VNFLTFWWELARWLDSWLLTALYSSDTHSRFNMMGFQNTSDDLIMNLVMGTMFLMLPAV
FT                   WIGALSWAGVHLGGAISNSMKTGTDKATQSSEKGGKVAEQAVSSFAGGMMKGK"
     atgacaacga acagctatct ggagtatttc ctgaccctgc tgggttggct ggtcaataat        60
     ggtctctggg atgtccttgt cagtaccgga ctctttgcgc tgccactggc ctttaaggtc       120
     gcgagtatct ggctgaaggt tcgtgaagaa ggcgaggatg aaggtaacaa gggcatgctg       180
     tcactgcccc gtatcgagaa tgcgctttat ggtgcgttct ttgtgatgat tgcctgttgc       240
     gtgccgctga ttcaggtaag tctgagtaca ctggagtttg ataaaagccg ggggaaaaca       300
     tgcgggacct ggaccccaaa agcgccgaat gaaactggct acagcggcat tatatctagc       360
     atggatggag aaagcgccgc agcaccagtt tggtgggtgc tggtccataa gctctccaaa       420
     ggcgtgacac aggcagctgt ggccagtatt ccttgtcggc cagatctcag gcaactgcgg       480
     tttgaggttc aacggacgtt cattgagaat cgtgctctgg ctgatgagtt gcaggatttt       540
     accaacgact gctattcgct ggcgctttac cagtggaaac ggcgtgacca ggggcagaca       600
     acagataagg cgactttgtc agacctcagt tggataggta gcagtacctt tcttaaagga       660
     gactatacca ccctgcagtc gaaattgccg cgcgggatgt tctcctggag tgacgcccgt       720
     gacagtggtc ggccgaatac cggtaatggg ggataccctt actgttctga gtggtggtcg       780
     gcagcagata ctggcctgaa ggccagggtg atgaagcagg ttgatgacag ctactggctg       840
     cggttatctg cggcgatgaa gatgattggc agcagccaga ctgattatca ggaagaggtg       900
     atccgccggc ttgtcagccc ggcgaacctg acggtatcgc atggaggtga agtatataac       960
     ggctatggtg gtaatgcggg tatgacggca atgaatgcga tttcccgtgt tgccggaacg      1020
     gcaggcgctt cggtggcctc actgggcgcg ttcccggctc tggacgcgat gcgtcaggca      1080
     ttgccgatgg tgcaggccgt tatactgatg gccatttata ttatggtgcc attaatcctg      1140
     acctttgcgg cttatgaatt caaaacggtg atcaccctga cgcttgtcat ttttgctgtg      1200
     aacttcttga cgttctggtg ggaactggcc cgctggctcg acagttggtt gctgacggcg      1260
     ctatacagtt ctgataccca ctcacgcttt aatatgatgg gattccagaa tacatcggat      1320
     gatctgatta tgaatctggt tatggggacg atgtttctca tgttgccggc tgtgtggata      1380
     ggggcattga gttgggcggg tgttcatttg ggaggggcta ttagcaacag tatgaaaacc      1440
     ggaacggaca aagctacgca atcaagtgaa aaaggaggaa aagttgcaga gcaagctgtt      1500
     tcatctttcg cgggtggcat gatgaaaggt aaataa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page