(data stored in ACNUC7421 zone)

EMBL: CP001600.PE328

CP001600.PE328       Location/Qualifiers
FT   CDS_pept        complement(360062..360280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67599"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI3"
FT                   /protein_id="ACR67599.1"
FT                   /translation="MNIFVKKLLNAVLPDPKPNNHTDDGSLLTCFNDEAETLFNDDPLV
FT                   ERTYEGLNAIDDGAPYGESYGTWSDSD"
     atgaatattt tcgtgaaaaa gctgttaaac gcggtgctgc ctgaccctaa gccgaacaat        60
     cacactgacg atggctcttt actgacatgc ttcaacgatg aagcagaaac gcttttcaat       120
     gatgatcctc ttgttgaaag aacctacgag gggttaaacg ctattgatga tggtgcccct       180
     tatggggagt cgtatggaac atggtctgat agcgactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page