(data stored in ACNUC7421 zone)

EMBL: CP001600.PE329

CP001600.PE329       Location/Qualifiers
FT   CDS_pept        360499..360996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0358"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67600"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI4"
FT                   /protein_id="ACR67600.1"
FT                   /translation="MDELSSVNKKISDFGVSIAGKQSSQNESGMPKLAPKVEADQDSTS
FT                   KDLSVPVDVDTAAARLRRYYKFMTTDELNSIKNRESTSARLTAAAIEEQRPEWSASVGS
FT                   YYKMGRNWGEGKDHITLEVEKNGAGSHVYIQFFSSNPQHLTEAYLGNLFAQVKDVAEGK
FT                   VR"
     atggatgagt tatcttccgt caataagaaa attagtgatt ttggggtatc aatagcagga        60
     aaacagtcat cacagaatga atcaggtatg cctaagttag cacctaaagt tgaagccgat       120
     caggattcca cgtcaaaaga tttatctgtt ccagttgatg tcgatactgc tgctgctcgt       180
     ttgcgtcgtt attataaatt tatgacgaca gatgagttaa atagtattaa aaatagagaa       240
     agtacttctg cccgtttgac tgctgctgcg attgaggaac agaggccaga atggtcggca       300
     tcggtaggga gctattataa aatggggcga aactggggag agggaaagga tcatattaca       360
     ttggaggttg aaaagaatgg tgccggaagc catgtttata ttcagttctt ttcttcaaac       420
     cctcagcatt taacagaagc ctatttaggt aatttatttg cacaggtgaa agacgttgca       480
     gagggcaagg ttcgataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page