(data stored in ACNUC7421 zone)

EMBL: CP001600.PE33

CP001600.PE33        Location/Qualifiers
FT   CDS_pept        complement(31840..32460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0035"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67295"
FT                   /db_xref="GOA:C5B9B5"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B5"
FT                   /protein_id="ACR67295.1"
FT                   /translation="MLLSILYIVGITAEAMTGALAAGRRQMDTFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLSWVKHPENIMIVACAAVLTTWLAPLMSHLRRLFLLLDAVGLMVFSIIG
FT                   AQVALEMGHGPIIAVVAAVITGVFGGVLRDLFCNQIPLVFQKELYAGISFAAAWLYLGL
FT                   LYLQVPQDLTVIITLVAGFTARLLALRFHLSLPVFDYKQPERE"
     atgttactga gcattctcta tattgtcggt attaccgcgg aggcgatgac cggcgcgctg        60
     gcggcgggac gtcgccaaat ggacaccttc ggggtgatca tcatcgcttc agccaccgcc       120
     atcggtggcg gctcggtacg cgatatgctg ctggggcact acccgctgag ctgggtcaaa       180
     cacccggaaa acattatgat cgtcgcctgt gctgcggtgc tgaccacctg gctggcgccg       240
     ctgatgtcgc atctgcgccg cctgttcctg ctgctggatg ccgtcggtct gatggtgttt       300
     tcgattatcg gcgcccaggt ggcactggaa atggggcacg gcccgatcat tgcggtggtc       360
     gccgccgtga tcaccggggt gttcggcggg gtactgcgcg atctgttctg caatcagatc       420
     ccgctggtgt tccagaaaga gctgtacgcc gggatctcat tcgccgccgc ctggctttac       480
     ctggggctgc tatacctgca ggtaccgcag gatctcacgg tgatcatcac cctggtggcg       540
     ggcttcaccg cccgtctgct ggcactgcgc ttccatctga gcctaccggt cttcgactat       600
     aaacagccgg agcgcgaata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page