(data stored in ACNUC7421 zone)

EMBL: CP001600.PE330

CP001600.PE330       Location/Qualifiers
FT   CDS_pept        361195..361818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0359"
FT                   /product="Uncharacterized protein family (UPF0153)"
FT                   /note="Uncharacterised protein family (UPF0153)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67601"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI5"
FT                   /protein_id="ACR67601.1"
FT                   /translation="MVESWHKCSEGVVDRIKNGKSLKSICQKGCSRCCSLHVSLLTPDV
FT                   FFIAENLTKDFSDSKLFFIKKRLKIRADKVEEYIDDSYRMECVFLGKTSGQCIIYKYRP
FT                   EACRRFFTNDEKDCIESNGSPLQDGAVFYSTGILSAYMALAAHNNDLFIDSHEVSKSLY
FT                   MALDRPLLFKKWLRGEPNVFPDVKWEGYHQEIKKMNADMKIKIK"
     gtggtagaaa gttggcataa atgttctgag ggggtggtgg atagaataaa aaacggaaaa        60
     agtttaaaat cgatatgcca aaaaggatgc tcgcgttgct gttcattaca tgtgtcatta       120
     ctcacacctg acgtattttt tatagctgaa aatttaacaa aggattttag tgactcaaag       180
     ttgtttttta ttaaaaaaag attgaaaatt cgagctgata aggttgagga atacatcgat       240
     gatagctata gaatggagtg tgtttttctc ggaaaaactt ctgggcagtg tattatctat       300
     aaatatcgtc cggaggcgtg caggcgtttc tttactaatg atgaaaaaga ttgcattgaa       360
     agtaatggtt caccacttca ggatggtgct gtgttttatt caactgggat tctttctgct       420
     tatatggctc ttgcggcaca taacaatgac ctatttatcg atagtcatga ggtgagtaag       480
     tctttatata tggctctgga taggcctttg ctttttaaaa aatggctgag gggcgagcct       540
     aatgtttttc cggatgttaa gtgggaaggg tatcatcagg aaattaaaaa aatgaatgct       600
     gatatgaaga tcaaaataaa gtaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page