(data stored in ACNUC7421 zone)

EMBL: CP001600.PE331

CP001600.PE331       Location/Qualifiers
FT   CDS_pept        363211..363765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0360"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67602"
FT                   /db_xref="GOA:C5BDI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI6"
FT                   /protein_id="ACR67602.1"
FT                   /translation="MPLAPDEFYKAFQAVEKKNPGVAAAMQLSYALGLRTKEAVEACKS
FT                   VPSWKRALESGQNSVRVVFGTKGGRPRDTVILDRDSVRAAINYAEKVMEKQNGKLVDRP
FT                   DIRKAIDTYRYQVRQIGLTGKKAPHSMRYHFSQEAKSFYERQGYTEREIFAQVSMDLGH
FT                   GDGRGKYVRQVYFKELPDDNG"
     ttgcctttag caccggatga gttttataag gcgttccagg ctgtggaaaa aaagaaccct        60
     ggcgtggcag ctgcaatgca actttcctat gctctgggat taagaacaaa agaagctgtt       120
     gaggcgtgta aatctgttcc gagctggaaa cgtgcactgg aatcagggca aaactccgta       180
     cgtgttgtat tcggaacaaa aggcggacgc ccccgggata ccgttattct tgaccgcgat       240
     tcggtcagag cagcaattaa ctatgccgaa aaagtaatgg aaaaacagaa tggaaaactt       300
     gttgaccgac ctgatataag aaaagcgata gatacttatc gctaccaggt tcgtcagatc       360
     ggtctgaccg ggaaaaaagc tcctcacagt atgcggtatc atttctctca ggaagcaaaa       420
     tccttttatg agcgacaggg ttataccgaa agagaaattt tcgcgcaggt ttccatggac       480
     ctgggacatg gtgacgggag aggtaaatat gtcagacaag tctatttcaa agaattgcct       540
     gatgataatg gttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page