(data stored in ACNUC7421 zone)

EMBL: CP001600.PE332

CP001600.PE332       Location/Qualifiers
FT   CDS_pept        363786..364208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67603"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI7"
FT                   /protein_id="ACR67603.1"
FT                   /translation="MRYDILMKATSVKPVYEIILEGNQCSEIVIAFNCETPLSESDTCA
FT                   MLARYFDNVYFEDNEHDTFTQKGDIFEMTGVIRVPPSEKTVHLNKGEVIIPITTRLTHQ
FT                   LMSQEYNARSEENVNGMVDNWIGDLFNKKGNLIINK"
     atgcgctacg atatattaat gaaagccact tcggttaaac ctgtttatga aattattctg        60
     gagggcaatc aatgcagtga aattgtcatt gcttttaatt gtgaaacacc gttaagtgaa       120
     tctgatacct gtgcgatgtt ggcaaggtat tttgataacg tgtattttga agataacgaa       180
     cacgatactt ttacgcaaaa aggtgatatt ttcgagatga cgggagtaat cagagtccca       240
     ccctcagaaa aaacggttca cctcaataaa ggggaagtta tcatcccaat taccacaagg       300
     ttgactcatc agcttatgtc tcaggagtat aatgccagga gtgaggagaa tgtaaacgga       360
     atggttgata actggattgg ggatctgttt aataagaaag gtaacctgat tattaacaaa       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page