(data stored in ACNUC7421 zone)

EMBL: CP001600.PE334

CP001600.PE334       Location/Qualifiers
FT   CDS_pept        365404..366459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0363"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67605"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDI9"
FT                   /protein_id="ACR67605.1"
FT                   /translation="MKTDNRKTTAKVCKKPTARKTASSGKRRQAGMAATLTGSGDIYRL
FT                   VTDRIIIALENGIPPWRRPWRNAQQGINTLMPANAFTGRGYSGVNVLLLWLAAEERGFT
FT                   SDRWLTYNQAQEAGGQVRKGETATLAVIYRDWTKQAEDSNGNKLFDADGKPQMETVPML
FT                   RQFPLFNAEQCADLPDQVRGTATVTRPQEDFADVSPVQLQQVLSVVNATGVQFSPRPQN
FT                   RAYYRVATDQIVLPLTSQFDAEGDYWSTVLHELVHASGHAKRLNREGITRASKKFGDPV
FT                   YAFEELIAEIGSAFLCAHLGITGDLQHESYVDGWLSKLKSDKKALFSACRQAREASEYL
FT                   LAPLNRQAETA"
     atgaaaactg ataatcgtaa aaccaccgcc aaggtctgta aaaagccgac agcacgcaaa        60
     actgcttcct caggtaaacg tcgccaggca ggaatggccg cgacgcttac tggcagcggc       120
     gatatttacc gtctggtcac tgatcggata attatcgccc tggaaaacgg tatacccccc       180
     tggcgacggc cgtggcgaaa tgcgcagcag gggataaaca ccctgatgcc ggccaacgca       240
     tttactggcc ggggctacag cggcgtgaat gttttgctgc tgtggctggc ggctgaagag       300
     cgtggtttta ccagcgaccg ctggctgaca tacaaccagg cacaggaggc cggtggccag       360
     gtccgcaagg gcgaaaccgc cacacttgcg gtgatatacc gcgactggac aaagcaggct       420
     gaagacagca atggcaacaa gttgtttgat gctgacggta agccgcagat ggaaacggtg       480
     ccgatgttgc gccagtttcc gctgttcaat gccgaacagt gtgctgatct tcctgaccag       540
     gtgcgtggca ctgccaccgt cacccgaccg caggaggatt tcgctgatgt cagtccggta       600
     caactgcagc aggtcctgtc ggtggtgaat gccaccggcg tgcagttttc accccggccg       660
     cagaaccggg cgtattaccg tgtcgccaca gaccagatag tgctgcccct gacatcgcag       720
     tttgatgctg agggtgacta ctggtcaacg gtgcttcacg agctggtgca tgccagtggc       780
     catgcgaagc gactgaaccg tgaagggata actcgggcgt caaagaaatt tggcgacccg       840
     gtgtatgcct tcgaggagtt gatagccgaa attggcagtg cctttctgtg cgcacatctc       900
     gggataaccg gtgatttgca gcatgaaagt tatgttgacg gatggctgtc aaaactgaaa       960
     tccgacaaaa aggcgctgtt cagtgcctgc cggcaggccc gggaagcgtc ggaatatttg      1020
     ctcgcaccac tgaaccgtca ggctgaaacg gcgtaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page