(data stored in ACNUC7421 zone)

EMBL: CP001600.PE335

CP001600.PE335       Location/Qualifiers
FT   CDS_pept        366567..367502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0364"
FT                   /product="Protein of unknown function (DUF1281)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67606"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ0"
FT                   /protein_id="ACR67606.1"
FT                   /translation="MSEWCQNRFEITGKSVCIDVLLQWINGADTPRYRHAILQSIQLFL
FT                   AGCAGILKPVRTVSYIPFQGLVRHGIGQSTAANLAFEQWLELLQKDVALDTETIRRIDR
FT                   LYHQSGLGALKWENIPLASRDIMATLMKRQYADWFGLAGMNDEPDAAACWERLREYPER
FT                   SQPCDMLMVIPTRLATELNGSGGLLAGISTTVSFYSHIYGMEWPAGHNVNLHRHAANGL
FT                   TLRLDSPWYPPSGEVVAGISALFECEVRHTYSEPVSGLSGYDCYDLGAHVDGHQGVPVE
FT                   TLPPAPALYLVSSEQPHPGPEMAGYSEVRG"
     atgtctgaat ggtgccagaa ccgttttgaa attaccggta aatctgtctg tatcgatgtg        60
     ttgttgcagt ggataaacgg tgcagacacg ccgcgttatc gccacgcaat actgcagagt       120
     atacagctgt tcctggcagg gtgtgcgggg atactgaaac cggtgcgaac agtctcgtac       180
     atcccctttc agggactggt tcgtcatggt atcgggcagt cgacggccgc taaccttgcg       240
     tttgagcagt ggctggagct gctgcagaaa gacgtggcgc tggatacgga gacaatacgc       300
     cggattgacc ggctgtatca ccagtccggc ctgggggcgc tgaagtggga aaatatcccc       360
     ctggcgtctc gggacatcat ggcgacgctg atgaaaaggc agtatgcgga ctggttcggt       420
     ctggccggca tgaacgacga gcctgatgca gcagcttgct gggagcgtct gcgggaatac       480
     ccggaacggt cacagccctg cgatatgctg atggttatcc cgacgcggtt ggccacagag       540
     cttaacggct ccggtgggct gctggcggga atatccacaa cggtcagctt ctacagccat       600
     atttacggta tggagtggcc agccgggcat aatgtaaacc tgcatcgtca tgccgctaac       660
     gggctcacgc tgcggctgga ttcaccctgg tatccaccgt caggtgaggt ggtggccggt       720
     atttccgctc tctttgagtg cgaagtgcgg cacacgtaca gcgaaccggt cagcggtctc       780
     agtggttatg actgttatga ccttggggcg catgtggatg gccatcaggg ggtgccggtg       840
     gaaacgctac cgcccgctcc ggcactttat ctggtcagta gtgaacaacc gcatcctgga       900
     ccagagatgg ctggttacag cgaagtccgt ggataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page