(data stored in ACNUC7421 zone)

EMBL: CP001600.PE336

CP001600.PE336       Location/Qualifiers
FT   CDS_pept        367621..368304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0365"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67607"
FT                   /db_xref="GOA:C5BDJ1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ1"
FT                   /protein_id="ACR67607.1"
FT                   /translation="MAGFIDHEKAFISLFNQTARYHHRHKVFEDFVSCSVIALENRLCF
FT                   SEKREGKYLRIIGGYEKPDVIRMAQLLAHVVNGLQNGLCNFLGNVFMQLELGDKYRGQF
FT                   FTPWDVARMMAQLQLGDVKAMFDEKPFITLHEPACGAGCMVLAFADALNQAGYASHLYL
FT                   WVSATDIDPLAAGMAYIQLSLCGVAGEVVIGNALCDERRRVLLTPGHYLGSWSLRLHSR
FT                   RKKVA"
     atggccggtt ttattgacca tgaaaaagca tttatctcac tgtttaatca gaccgcacga        60
     tatcatcacc gccataaggt attcgaagat tttgtcagct gcagcgttat tgcactggag       120
     aaccgtctct gttttagcga aaagcgggaa ggtaaatatc tgcgaataat tggtggttat       180
     gaaaagccgg atgttatccg tatggcacaa ttgctggccc acgtggttaa cgggctgcag       240
     aatgggttat gtaattttct gggtaacgtg tttatgcagc tggaactggg cgataagtat       300
     cgcggccagt tcttcacccc ctgggatgtg gccagaatga tggcgcaact gcaactgggg       360
     gatgtgaagg caatgtttga tgaaaaacct ttcatcactc tccatgagcc cgcctgcggt       420
     gcgggttgca tggtgctagc ttttgccgat gctcttaatc aggcaggcta cgcgtcgcac       480
     ctctatctgt gggtttccgc gacggatatt gatccactgg ccgctggcat ggcctacatc       540
     cagttatcac tctgcggcgt ggccggtgag gtcgtcattg gcaacgcatt atgtgacgaa       600
     cggcggcggg tactgctgac gccgggccat tatctcggta gttggtcgct tcgtctgcat       660
     tcacggcgaa aaaaagtcgc ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page