(data stored in ACNUC7421 zone)

EMBL: CP001600.PE337

CP001600.PE337       Location/Qualifiers
FT   CDS_pept        complement(368530..370116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67608"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ2"
FT                   /protein_id="ACR67608.1"
FT                   /translation="MCNKTLTLKKKSLQTVELPTDYDRLLQSITLLAPVQKVSLDIDVT
FT                   HKAALPAVIESALLLVAQLETVSPLELGGFFGLADHERQVLVDEMIDTGLVRYNDEGDI
FT                   ATTIRLTMQRREGAADEGIAIEDVENHRGFTFIDLCTGHIQPKCNADLQKGLPELARKI
FT                   NSSDFTDLIADQFRRFQVCLPDTKSMRALRSSKARLYRVNRASVGQSGLKQQISLDVHA
FT                   HSDPLNGIRLEARLMDYSSEHTRLMESSGLKTEAINWLHERKLEAATTTLEDYCDLAKD
FT                   TVIRRYIGRGGKLDLGRLLHDRQRRKTGYGDSATQRMIIGPVYAASNRDTLIKWAKWLP
FT                   LNQRTHQGVWLGATNELFGASLGFGSFIKQMNTELGSGERNSRLNLAFQCDEEYRAQRL
FT                   ITNLFNSRTDGSLRIFQKGRSESHLEMLVFPGEQGMAVVQYHAALDPSLGYAGLTLPIG
FT                   YFTTDPERVALLWAQVQQRIQSPLRSANQPEVVLDDLDQLLGCTSAELTQLLVDNSEEK
FT                   LKKLVEKFNQH"
     atgtgtaaca agacccttac cttgaaaaaa aaatcgctgc aaaccgtgga actgccgact        60
     gattatgacc gcttgctgca aagtattacc ctgctggcac cagtacagaa ggttagtcta       120
     gacattgacg tgacacataa agccgcgcta ccagcggtta ttgagtcggc tctcctactg       180
     gtggcgcaac tcgagacagt gtctccttta gagctagggg gctttttcgg actggccgac       240
     catgaacgtc aggttctagt tgatgaaatg atcgacactg gcctcgtgag atacaatgat       300
     gagggcgata tcgcgaccac gatccgtttg actatgcaac gtagagaagg cgcagcggat       360
     gagggcattg cgattgaaga tgtggaaaat caccgtggct ttactttcat cgacctttgt       420
     actgggcaca ttcagcccaa gtgtaatgca gacctacaga aagggctgcc cgagttggca       480
     cgtaagatca atagcagtga tttcactgat ttgatcgccg atcaatttcg tcgctttcag       540
     gtttgcttac ccgataccaa gagcatgcgc gcactgcgta gctccaaagc ccgactttac       600
     cgggtgaatc gggcctctgt cggccaatcg gggttgaaac agcaaatatc actcgatgtt       660
     catgcccatt ccgatcctct gaacgggata cgtctcgagg cacggttgat ggactatagc       720
     tcagaacata cgcgcttgat ggaaagctca ggactcaaaa cagaggctat taactggctg       780
     cacgagcgca agctagaggc cgccactacc acacttgaag actattgtga cctggcaaaa       840
     gacacggtga tccgtcgata tataggacgc ggtggtaaac tggacctagg gcgtttactt       900
     catgatcgac aacgcagaaa aaccggctat ggtgacagtg ccactcaacg tatgattatt       960
     gggccagtct atgctgcctc caaccgtgac accttgatca agtgggctaa atggttgcca      1020
     cttaaccagc ggacgcatca aggggtctgg ctgggagcta ccaacgagtt atttggcgct      1080
     agcttaggtt ttgggtcgtt catcaagcaa atgaatactg agctcggcag tggagagcga      1140
     aacagtcgcc tcaatttggc atttcagtgc gatgaggagt atcgagcaca gcgcttaatt      1200
     accaatttgt ttaacagccg taccgacggc agcctacgta ttttccaaaa aggccgttct      1260
     gagtcgcact tggaaatgct ggtgtttcct ggcgagcaag gcatggccgt ggtccaatac      1320
     catgcagccc ttgatccgtc actcggctac gccggcctca cgttgccaat cggctacttc      1380
     acgacggacc cagagcgggt agctctgttg tgggcgcagg tgcaacagag aatccagtcg      1440
     ccgcttcggt cagccaacca gcccgaggta gtactagacg atcttgatca gctactgggt      1500
     tgtacttctg ctgaactgac acaactactg gtcgacaatt ccgaggaaaa actgaaaaaa      1560
     ctggtggaaa aattcaatca acactag                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page