(data stored in ACNUC7421 zone)

EMBL: CP001600.PE338

CP001600.PE338       Location/Qualifiers
FT   CDS_pept        complement(370109..375070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0367"
FT                   /product="Nuclease-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67609"
FT                   /db_xref="GOA:C5BDJ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ3"
FT                   /protein_id="ACR67609.1"
FT                   /translation="MKIHIAATQGLHQNEHDAIIAMEKALPAHWVGYAGILLVDKNRKS
FT                   LEFDVLIFAEDRILMVELKNFHGQIHMEDDQWIQTTPGGRKIKHGSPIDRKREHAQRIK
FT                   SMFDEELRALWGNTFYEIQALVVLTGEAKVTQQSPKDKGFVLALDEFLTIANLDTYFDK
FT                   MPETRAEGYFRRHPEKRPCAPGQIAIFEKWKRGGSYVQIRQRLEAGYVLSEKIPRLKGP
FT                   KGFYNEFDGEHERDLEDKSQIRMWDFSKMAHVGTDMSVRVFFGLREDRTQRHIRRTDSQ
FT                   LGKDYLLEPKHNLQEDTLTIDMAEVYQLPRLAERLDEFLVSSPLSIEKRTLLLRALLTP
FT                   LAGMHAMGVYHRDLSSKRLWWDRERNAIIISGLTSAKFPDLGHKSISDMRQDMDTTGIL
FT                   LPEDAFGETEVLGQAVDVFQLGVLCYQIAYGEQLTLPRDEPPQWKQPLNDPFEGKLDGF
FT                   IQQSLELDASKRHTDAGAMLETLTRTLNFQNLDSNEDKARVLDALAAFNTDAMPITEYP
FT                   QVETPSTDPQRQRMTFRSKTIDGQPCTVRIYLNARPNKDNHGQSQRLLHFLERCAIASN
FT                   NVLSLPPLIEFGCGMMGTHVVQSYALGESLEQWMTRPNRSYEERYQLADALIRAVHNLH
FT                   DLDLSHGDLKPENLLVQAEGGKLSILLLDMFDLDLDGLAPANSEYAPTTDVSATARDRY
FT                   AVYMIVDEIFAACIHHGANKIRGEIRNALGDKNAVPRSLDMLRRTMIHANEPELVEATP
FT                   LVIESLYFPNEQGELFEMDSGIYHLTASYTPKSNVLKLFFLGVSHKLTLNLKVDGQSLT
FT                   VHRMFYDRLGTGEIVYDTRNNRKNGNRAMSVGQPFIIKKGPFVAENTELLGFIRTLHVV
FT                   QHALDIKPESEEHPTVVAGDQEGYLKRLWLRLVEVERETLPTVKVIASPKELDGIVHVQ
FT                   INENIDSLEFAEDDVINVTMDDHETHFGQLDVAKSGNGVLVFSDDNRGNNFRLQNIRED
FT                   TILTLSNSGSDVSWERRDRALSRIVASDAVMGDLTDRFMNGPRGFQPPALPIPTDEQIN
FT                   RYGLDESKRAAFLYLLQNPLSVLMGPPGTGKTTLLSAALDYLLNDANVRRVLVVSQSHT
FT                   AVDEVANRVRELSFKRQEQSPDFKLPSIVRLGERRRVSEGMLDVHTNALQAQARTAFHR
FT                   DLEVRLLALSARLKLPEAFVLESAALYRACGRELFEFTPARNEVREAQQDGVDVDNLPN
FT                   DKRMIRLTTERRLDNLKNALIGRLSAFTDMPNQVLLHNKPLLAVLNMIAERHQINNPQR
FT                   IERMAEVIKVAHHWYQRLATDETGYAAFAARTRQLVVGTLVGIGHGGYQLDKNAFDLVV
FT                   IDEAARATFSELAIAMQSAKRVLLVGDYKQLAPSYDVSHVRQVARDLGLNEADVKRTDF
FT                   ERAYALNDGHMLSKQYRMAPAIGDIISHCFYDGTLATGRPPAPEWMSSLPTPWDRTVSW
FT                   IDTSDSKVLETNISKGIANEVEVNLLCSLLRQLVDDEQAMLQLRQWNDADTTPAIGIIT
FT                   GYRKQVELLQKRLESESWAAPIRSMMKVDTIDSYQGSENRIILLSLVRHNAEQKGGFMT
FT                   DNARVNVALSRAKERLLIIGAGSMWQQADACQPLARVFDYIHQQLPCQDSEYQIIRSAD
FT                   LTHNACTELQENDYV"
     atgaaaatac atatcgcagc aacgcaaggg ttacaccaaa acgagcacga tgccattatt        60
     gccatggaga aagccctgcc cgcacattgg gttggatatg cgggtatctt gctggttgac       120
     aaaaatcgca aaagtctaga atttgatgta ttgatcttcg ccgaagatcg catcttgatg       180
     gtagaactta agaacttcca tggtcagatt catatggaag acgatcagtg gatccagacc       240
     acgccaggtg ggcgtaaaat caagcacgga tctccaattg accgcaagcg cgagcacgct       300
     caacgaatca aatccatgtt tgatgaagaa ttgcgcgcgc tgtgggggaa tactttctac       360
     gaaatccaag cgttggtggt tctcactggc gaagccaagg tcacacagca atcgccaaaa       420
     gacaaaggtt ttgtgctagc gcttgatgaa tttttgacca ttgcaaatct agatacctac       480
     tttgacaaga tgcccgagac cagggctgaa gggtattttc gccgccatcc tgaaaagcgc       540
     ccttgcgcgc ccggacaaat tgccatcttt gagaaatgga agcgtggagg gagttatgtc       600
     cagatccgcc agaggctcga agcaggctat gtgctcagtg agaagatccc acgtctaaaa       660
     ggccccaagg gcttctacaa tgaattcgac ggtgaacatg agcgtgattt ggaagataaa       720
     agccagatac gcatgtggga cttctctaag atggcccatg tcggcacaga tatgtctgtg       780
     cgcgtctttt ttggcctacg cgaggaccgt acgcagcggc atatacgtcg aaccgatagt       840
     caactgggca aagactatct gctggagccc aagcataacc ttcaggaaga tacccttacc       900
     attgacatgg ctgaagtcta ccaacttcct cgactagctg agcgtttgga cgaattccta       960
     gtatcctcac cattatcgat tgaaaaacgc accttattat taagagcttt gctaactcca      1020
     ctggccggta tgcatgccat gggggtatac caccgcgatt tgagttctaa acgcttgtgg      1080
     tgggaccggg aacgaaatgc catcataata agtggactga ccagtgcgaa gtttccggat      1140
     ttgggacaca aaagcatcag cgatatgcgt caggatatgg atactaccgg tatcttactg      1200
     ccagaagatg cctttggtga gaccgaggtg ctggggcaag cggtcgatgt gttccaactg      1260
     ggggtactat gctaccaaat tgcctatgga gagcaactga ccttaccccg agatgagccg      1320
     ccccaatgga agcagcccct aaatgaccca ttcgagggta aacttgatgg atttatccag      1380
     cagagcctag agctcgatgc gtcaaaacgc cacaccgatg cgggtgcaat gctggagacg      1440
     cttacgcgaa ccctcaattt tcaaaacctc gactctaacg aagataaggc ccgggtactc      1500
     gacgctttag ctgcattcaa cactgatgct atgccaataa cggaatatcc tcaggtggaa      1560
     acgccgagta cggatcccca gcgccaacgc atgactttcc gctccaaaac aattgatggg      1620
     caaccctgta ctgttcgtat ctatttaaat gcacggccca acaaggacaa tcatggtcag      1680
     tcccagcggc tgctgcactt ccttgagcgc tgtgcaatcg cctccaataa tgttttgtcg      1740
     ctcccgccat taattgaatt cggctgcggc atgatgggaa cccatgttgt tcagtcttat      1800
     gccctagggg aaagcttaga acaatggatg acgcggccca accgtagtta tgaggagcga      1860
     taccagttgg ctgatgcgct gatccgtgca gttcataacc tacatgattt ggatcttagc      1920
     catggtgatc tgaagcctga aaacttgttg gtgcaagcgg aaggcggcaa gctgagcatt      1980
     ctgctcctag atatgtttga cttggatcta gacggtctcg ctccagccaa ttctgagtac      2040
     gccccaacga ctgatgtcag cgccactgca cgtgatcgct atgctgtata catgattgta      2100
     gatgagatat ttgcggcctg cattcaccat ggtgccaata agattcgtgg ggagattcgt      2160
     aatgcgttag gggataaaaa cgcagtgcct cgtagcctcg acatgttacg gcgcacgatg      2220
     atacatgcaa acgaacccga gttggtcgag gctacgccac tggtgatcga aagtttgtat      2280
     ttccccaacg agcagggcga attattcgag atggactctg gcatctacca tctgacagcc      2340
     agttataccc ctaagagtaa tgttctaaaa ttattcttct tgggtgtctc acataaattg      2400
     acgcttaatc tcaaagttga tgggcagagt ctcaccgtgc accgtatgtt ctatgaccga      2460
     ctgggtacgg gagaaatagt gtatgacacc cgtaacaacc gcaagaatgg taaccgtgcc      2520
     atgtcggtgg gacagccttt tataattaaa aaagggccat ttgtcgcgga aaatactgaa      2580
     ttattgggct ttatcagaac attacatgtg gtacagcatg ctctggacat caaaccagag      2640
     tcagaagaac acccgacggt agttgccggt gaccaagagg gatacctaaa gcgtctctgg      2700
     ctgcgcctag tagaagtaga gcgcgaaacc ctgccaaccg tcaaagtgat agcgagccct      2760
     aaggagctcg atggtatcgt tcatgtccaa attaatgaga acattgactc tttagagttt      2820
     gccgaagatg acgtgattaa cgtaacaatg gatgatcatg aaactcactt cggccaactg      2880
     gatgttgcta agtctggaaa cggtgtgctg gtgttctcag atgacaaccg cggtaataac      2940
     ttccgcctgc aaaacattag agaagacaca atcctgactc tttctaattc gggaagtgac      3000
     gttagctggg agcggcgaga ccgggcatta tcacgtattg ttgctagcga tgcagtgatg      3060
     ggggatctaa ctgatcgctt catgaatggc cctcgaggtt tccagccgcc tgcattgccg      3120
     atacctaccg acgaacaaat caaccgctat ggactggatg agtctaaacg cgccgcattc      3180
     ctgtatttac tgcagaatcc actcagcgta ttgatggggc ctccgggtac gggaaaaact      3240
     acactactta gcgcggctct agactatctg ctaaatgatg cgaacgtaag gcgtgtactg      3300
     gttgtgagtc aatcgcatac tgcggtcgat gaagtggcca accgtgtgcg cgagttaagc      3360
     tttaagcgcc aagaacaatc cccagatttc aagctgccaa gcattgtgcg cttgggtgag      3420
     cgccgccggg tcagtgaagg tatgctggat gtccatacta atgccctaca ggctcaagct      3480
     cgaaccgcgt ttcaccgcga tcttgaagtc cggctgctgg cactgtctgc acgcctgaaa      3540
     cttcctgagg catttgtgct ggaatctgcc gcgctgtatc gagcctgcgg tcgtgaattg      3600
     ttcgagttca cccctgcccg aaatgaagtc agggaggctc aacaagatgg tgtcgatgtg      3660
     gataacctgc caaatgacaa acgaatgatt cgcctgacaa ctgaacgtcg cctagataat      3720
     ctcaagaacg ctttaattgg ccggttgtca gcttttaccg atatgcccaa ccaagtgttg      3780
     cttcacaata agccgctact cgcggtactc aatatgattg cagagcgaca ccagattaac      3840
     aatccgcagc gtattgaacg gatggctgag gtgattaagg tggcccacca ctggtatcag      3900
     agattagcca cagacgagac cggctacgcc gcctttgcag ctcgcacccg tcaactagtt      3960
     gttggcacat tggttggcat cgggcatggc ggataccaat tggacaaaaa tgcatttgac      4020
     ttggtggtaa ttgatgaggc tgcgcgcgct acgttctccg agctggccat agcaatgcag      4080
     agtgcgaaac gagtgttgtt agtaggggac tacaagcaat tggcacccag ctacgatgtg      4140
     agtcatgtac gtcaggtcgc gcgcgatcta ggtcttaacg aggccgatgt gaaacgaaca      4200
     gactttgagc gcgcttacgc cttgaatgat ggtcacatgc tatcgaagca atatcgaatg      4260
     gcaccagcga ttggtgacat cattagtcac tgtttctatg acggcactct tgcgactggg      4320
     cggcctccag ctcccgagtg gatgtcctcc ctccccaccc cgtgggatcg caccgtgtca      4380
     tggatcgata cctctgatag taaggtccta gaaacgaata tcagcaaagg gattgccaat      4440
     gaagttgaag ttaacctgtt gtgtagcctg ctgcgacaat tggtcgacga tgaacaggcg      4500
     atgttgcagt tgcgtcagtg gaatgacgca gatactactc cagctatcgg gattattact      4560
     ggctatcgca agcaggtgga gctcttgcag aagcggctgg aatctgaatc ctgggccgcc      4620
     ccgattcgct caatgatgaa ggttgatacc attgactcct atcaaggatc tgaaaatcgc      4680
     atcatcttat tgagtttagt gcgacataac gctgagcaaa agggcggatt tatgaccgat      4740
     aatgcccggg tcaatgttgc cctctctcgg gcgaaagaac gcttgttgat catcggtgct      4800
     gggagtatgt ggcagcaggc ggatgcctgt cagccactgg cccgtgtatt cgactatatc      4860
     catcagcagc tcccatgcca agatagcgaa tatcagatca ttcggtcggc tgacctgact      4920
     cacaacgctt gcaccgagct gcaggagaat gactatgtgt aa                         4962
//

If you have problems or comments...

PBIL Back to PBIL home page