(data stored in ACNUC7421 zone)

EMBL: CP001600.PE339

CP001600.PE339       Location/Qualifiers
FT   CDS_pept        375659..377131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0368"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67610"
FT                   /db_xref="GOA:C5BDJ4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ4"
FT                   /protein_id="ACR67610.1"
FT                   /translation="MTWKTTPEQNAIIEWRGNQLVVNAFAGTGKTTTLVQFAQANPESK
FT                   MLYLAYNRAIRDEAEQKFPFNVECKTSHQLAWSHFGRHFRHRLTANLRITDVARKLNTR
FT                   HWPLARLALTGLNAFLGSAESEPGIIHLPTEDERHGLSADKILGAVQALWYEVSRTESD
FT                   FPITHDVYLKLFQLSGPNLARKWDTLLFDEAQDANPVTSAFVLSQPCRIVLVGDRYQQI
FT                   YRFRGADNALSSPRLEQADRLWLTTSFRFGPAVAQMANMLLAMSGEEIKVTDSGEDDEV
FT                   VTHLPADVPHCSVLSRTVSGVIGAALSASLQEKKVFWVGGIEGYKTEELEDLYWFSADM
FT                   PERMQSPRLGQDYQDFDEYCAIAKATQDVEMNQAIRLLDEYFPLPQKLAIMRRQVVTHE
FT                   KDAQVTVSTAHRSKGLEWDVVVLNEDFCDISDPLLSAEERQDETNLLYVAVTRARKTLV
FT                   LNELMLFLKQKDCEQPVTGDAENDEGEVIFPC"
     atgacctgga aaaccacacc ggaacaaaac gccatcatcg aatggcgggg caatcagctc        60
     gtggtcaacg cgtttgccgg caccggtaaa accaccacgc tggtacagtt tgcgcaggcg       120
     aaccctgaga gtaaaatgct gtaccttgcc tacaacagag ccatccgcga cgaagccgaa       180
     caaaaattcc ctttcaacgt tgagtgtaaa acctcccatc aactggcctg gtcgcatttc       240
     ggccgacatt tcaggcaccg gctgacggca aatctgcgta ttaccgatgt ggcccggaag       300
     ctgaataccc ggcactggcc gctggcgcgt ctggcgctga cggggctgaa tgcgtttcta       360
     ggtagtgctg agtcggaacc tggcattatc catctgccga cagaagatga gcgtcatggc       420
     ctctctgcgg acaaaattct gggggctgta caggctctct ggtatgaggt gagtcgtact       480
     gaatctgact ttccgatcac gcatgacgtc tacctgaagc tctttcagct ttccggtccg       540
     aatcttgccc gtaagtggga cacccttctt tttgatgagg ctcaggacgc caatccggtc       600
     accagtgcct ttgtcctcag tcagccctgc cggatcgtgc tggttgggga tcgttaccag       660
     cagatttatc gcttccgtgg tgcggataat gcgctcagtt ctccccggct ggaacaggcc       720
     gatcggttgt ggctgacgac cagttttcgg tttggcccgg cggttgcaca aatggcgaat       780
     atgctgctgg ccatgtccgg ggaggagatt aaagtcaccg acagtggtga ggatgatgaa       840
     gtggttacgc atctgcctgc tgacgttcct cattgctccg ttctcagccg gacagtatct       900
     ggtgtgattg gtgccgcgct ctctgccagc ctacaggaga aaaaggtctt ctgggtgggc       960
     ggtattgaag ggtacaaaac ggaagaattg gaggacctgt actggttctc tgccgatatg      1020
     cctgaacgga tgcaatcacc tcgccttggt caggattacc aagattttga tgaatattgc      1080
     gctattgcaa aggcgacgca ggatgtggag atgaatcagg ccatccggtt gctggatgag      1140
     tatttccctc tgccacaaaa gctggccatc atgcgccgtc aggttgtgac gcatgaaaag      1200
     gatgcgcagg tcaccgtttc tactgcacat cgcagtaagg ggttggaatg ggatgtcgtc      1260
     gtactgaatg aggatttttg tgacatctcc gatccgctgc tctccgcaga agagcgacag      1320
     gacgaaacca atctgctgta tgtggccgtg acccgtgccc gcaaaaccct ggtgttgaac      1380
     gagctgatgc tgttcttgaa gcagaaagat tgcgagcaac ctgtaacggg tgatgcggag      1440
     aacgatgagg gagaagtgat ttttccatgt taa                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page