(data stored in ACNUC7421 zone)

EMBL: CP001600.PE34

CP001600.PE34        Location/Qualifiers
FT   CDS_pept        32463..32636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67296"
FT                   /db_xref="GOA:C5B9B6"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B6"
FT                   /protein_id="ACR67296.1"
FT                   /translation="MGMLVRKAREGIEKGQDSQPGQAVRLSFSKVCCFELLLIMYIFII
FT                   CGILFYFLIIMD"
     atgggtatgc tcgtccgtaa agccagggaa gggatcgaaa aggggcagga tagtcagcca        60
     gggcaggctg tgcgactgag tttttctaag gtatgctgtt tcgaattact tttaataatg       120
     tatatattca ttatatgcgg tattttattc tattttttga taataatgga ttag             174
//

If you have problems or comments...

PBIL Back to PBIL home page