(data stored in ACNUC7421 zone)

EMBL: CP001600.PE340

CP001600.PE340       Location/Qualifiers
FT   CDS_pept        377125..378717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0369"
FT                   /product="Protein of unknown function (DUF1528)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67611"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ5"
FT                   /protein_id="ACR67611.1"
FT                   /translation="MLNKIKTLLSRTPAVTEPSNKLPVSVPTGYFSPAKAEELVITALR
FT                   QDALQKIRENNALSAEVYQRFYLAPVLLLLERTQNVPAAPDGRWAYAGGFGDLSLRFTA
FT                   YAVRLARGYMFPPGAAPEEQAAQGVIWQAVIFWAALCYHLPLLASIEGETTGGVNWQPG
FT                   ISVPDAPYRFRFRHSPPNAHDASALAALAAGQLLPTEAINWLSGTPAALFSLACAFRNG
FT                   SPDMPLIRTLLDQAAEKVDSPVLRKETGGSSVVIAPPDSVTSQEGALVVQTDDNLSSSA
FT                   VELAASELMTPLNDTGGGDRQPPQNGVSTVESPEEPDNASPGLGDADMLLSLFSAVADA
FT                   EVSEVADDASVNTLATVAPDETVVVIGKDAPEESAETEESFRHRDTDSGGRLPGTHEEQ
FT                   SHPINVGADARRSGEVFLAWLSDGVASGRITVNQHDSRVHSVAGFIYLLVPDIFFLFLK
FT                   DTGSDSHREEIQTSFEKLQLHRVRRGERFIRAKLYCSENKQGRFSRVNGYLIKAVRLKG
FT                   VRPQEDSKLLFFP"
     atgttaaata aaatcaaaac gttattatcc cgtacgccag ctgtcacaga gccatccaac        60
     aaactccccg tttcggtgcc gacggggtat ttctctccgg ctaaggctga agagttggtc       120
     atcactgcat tacgtcagga tgccctgcag aaaattcggg aaaataacgc actatcagca       180
     gaggtatacc agcgatttta tctggcccca gtgctcctcc tgcttgaacg gactcaaaat       240
     gtaccggcgg cacctgacgg ccgatgggcg tatgcagggg gatttggtga tttaagcctg       300
     cgctttaccg cttatgctgt caggcttgct cggggatata tgtttccgcc tggtgcggca       360
     ccagaagagc aggccgccca gggcgttatc tggcaggccg ttattttctg ggctgcgttg       420
     tgttatcacc tgccgttact ggccagtatt gaaggcgaaa ccaccggcgg cgttaactgg       480
     cagccgggca tatctgtgcc ggatgcgcct tatcgcttcc ggtttcgtca ttctcctccg       540
     aacgcgcatg atgcttctgc tctggcggcg ctggccgccg gtcagttgct ccccactgaa       600
     gcgataaact ggctttcagg taccccggca gcattgttca gtcttgcctg tgcatttcgc       660
     aatggttctc ctgatatgcc cctcatcagg acgttgctcg accaggcggc agagaaggtt       720
     gattcgccag tactccggaa agagacaggt ggatcttctg tggtaattgc gccgccagat       780
     tcggtaacgt cacaggaggg ggcgttggtt gttcagacgg acgataactt atcctcttct       840
     gcggtagagc tggccgcttc ggagctgatg acgccactca acgatactgg tggtggggac       900
     agacagccac cgcagaacgg ggtaagtaca gtggagtcgc cggaagaacc ggataacgcc       960
     agcccgggcc tgggggatgc cgatatgctg ctcagtcttt tttccgcagt ggcggatgca      1020
     gaagtctcgg aggttgcaga tgacgccagt gtgaatacgc tagccacggt agcgccggat      1080
     gaaactgtgg tggtcatcgg gaaagacgct cctgaagagt ctgctgagac ggaagagtcc      1140
     ttccggcatc gcgataccga ttccggtggt cggttgcctg gcacgcatga agagcagagc      1200
     cacccgatta atgtcggtgc tgatgcccga cggtcgggtg aggtgtttct cgcctggctg      1260
     tctgacggcg tggcatccgg caggatcacc gtcaaccagc atgattcacg ggtgcattcc      1320
     gttgccggct ttatttacct tctggtgccg gatattttct ttctttttct gaaagatacc      1380
     ggaagtgaca gccacaggga ggagattcag acctcgtttg agaaactcca gctccaccgt      1440
     gttcgcagag gggaacgttt tatccgggcg aaactgtact gctcagaaaa caaacagggg      1500
     cggttcagca gggttaatgg ttatcttatc aaggctgtcc gcctgaaagg cgtgagacct      1560
     caggaggaca gcaaactcct tttctttcca tag                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page