(data stored in ACNUC7421 zone)

EMBL: CP001600.PE341

CP001600.PE341       Location/Qualifiers
FT   CDS_pept        378778..379788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0370"
FT                   /product="site-specific recombinase, phage integrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67612"
FT                   /db_xref="GOA:C5BDJ6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ6"
FT                   /protein_id="ACR67612.1"
FT                   /translation="MRNEITWDELLEEYFFAHRLRPATEWSYSKVVRGFRRYSCDTLPA
FT                   QITHRQVLEWRRYLLQDKQQSAQTWNNKIAHLRALYNYGMEYEILPPGKNPFNKSNVQR
FT                   DTRKKKTLTRSQLIRVYLVMQQFEEAERAGHGIRGGRNALWPAWYWLTVLDSFRYTGMR
FT                   LNQLLHIRLGDINLSEGYLDLCLEGSKTHREWRVPIVSALKPRLHHLTEKSTELGAGNE
FT                   DYLFDVNRIHLKRHMAWDAAKVYQKIRSFFRRLSKECGFAVSPHRFRHTLATELMKSPE
FT                   RNLQLVKDLLGHRSVSTTMEYVELKMDIVGKTLEAELSLHTDVTGERNLHLLTQA"
     atgcgtaatg aaataacctg ggatgaactg cttgaagaat atttttttgc tcaccggcta        60
     agacccgcga ctgaatggag ctacagcaag gttgtcagag ggttcaggcg ttattcttgc       120
     gatacccttc cagcgcaaat tacgcaccgt caggtgctgg agtggcggcg ttatctgctt       180
     caggataaac aacaatcggc acagacgtgg aataacaaaa tcgcgcatct gcgggcgctg       240
     tataattacg ggatggagta tgaaatcctt cccccgggga aaaatccgtt caataaaagc       300
     aatgttcagc gagataccag gaagaaaaaa acgcttacgc gatcacagct gattcgcgtt       360
     tacctggtca tgcagcagtt cgaagaggct gagcgggcag ggcacggcat caggggtggg       420
     cgtaatgcac tctggccggc gtggtactgg ctgacggttc tggattcgtt cagatataca       480
     gggatgcggt taaatcagct gctgcatatc cggctgggcg acatcaatct cagtgagggg       540
     tatctggatc tctgccttga gggcagtaag acacaccgtg agtggcgggt tcccattgta       600
     agtgcgttaa agccccgcct gcatcacctg acagaaaaat caacagagct gggagcgggg       660
     aatgaagatt atctgtttga tgtgaacaga attcacctta agcgtcatat ggcatgggat       720
     gcagctaagg tctatcagaa gatccgatca ttttttcggc gactgtcgaa agaatgtggc       780
     tttgcggttt caccgcatcg ctttcgtcat acgctggcga cggaactgat gaaatcacct       840
     gaacgaaatc ttcagctggt aaaggacctt ttggggcacc ggagcgtcag tacaactatg       900
     gagtatgtgg agctgaagat ggatatcgtg ggaaaaacac tcgaagctga gctgtcactt       960
     cacacagatg ttacaggcga aagaaattta cacctgttga cacaagcgta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page