(data stored in ACNUC7421 zone)

EMBL: CP001600.PE342

CP001600.PE342       Location/Qualifiers
FT   CDS_pept        380656..381294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0372"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67613"
FT                   /db_xref="InterPro:IPR021236"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ7"
FT                   /protein_id="ACR67613.1"
FT                   /translation="MKRILTATALSLAMFSTFTWAADAAPAASAATTAAAGMSAQQVQD
FT                   VAKVAQQGFTAMRDMQFARVALFRGSPEVATKLTDQAAGLLADDSTDWKAFIKSDKKAP
FT                   LAGDNYVIINASIALSEDFVATPEKQKAIARANEKLSKGDRKGALEELRLAGVGITETQ
FT                   YLMPLKQTRQAVAHAQSLLKAGKYYEANLALKGAEEGIITDSVTLAGGK"
     atgaaacgta ttctgacagc aacagcgctt tctctggcga tgttttctac ctttacctgg        60
     gctgccgatg cagcgccggc agcatcggct gccacgactg ctgctgcggg gatgtctgcc       120
     caacaggtgc aggatgttgc caaagttgcc cagcagggct ttacggcaat gcgtgacatg       180
     caattcgccc gtgttgccct gttccggggc tctccggagg tggcgaccaa actgaccgat       240
     caggccgccg gtctgttggc cgatgacagc accgactgga aggcgtttat caaatccgat       300
     aaaaaagcgc cgttggccgg cgataattat gtgattatta acgcatccat tgcgttgtcc       360
     gaagatttcg ttgcaacccc ggaaaaacag aaagccattg ccagggccaa tgaaaaactg       420
     agcaagggcg atcgtaaggg cgcgctggaa gagctgcgct tagctggcgt gggtattacc       480
     gaaacgcagt atctgatgcc gctgaagcag acccgtcagg ctgtcgctca tgcacagagc       540
     ctgctgaaag ctggcaagta ctatgaggct aacctggcac tgaagggcgc tgaagagggg       600
     attattaccg acagtgtaac gctggccgga ggcaaataa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page