(data stored in ACNUC7421 zone)

EMBL: CP001600.PE343

CP001600.PE343       Location/Qualifiers
FT   CDS_pept        complement(381358..381933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0373"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67614"
FT                   /db_xref="GOA:C5BDJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ8"
FT                   /protein_id="ACR67614.1"
FT                   /translation="MQREQILTQALQRLERHGLAGATLPALIDSEMLSLDQARRYWPDS
FT                   EALLYDCLRFHSQQIDTWRRQLLLNDTLSHDDKILARYSVLAEHVEQGRFPGCLFISAC
FT                   IQYPVTDHPIHQLASRQKQASFDFTLQLLQESEIDDASLVAHQMELVQEGCLNRLLVSR
FT                   RREDVDIALHLAQDILHIAHCRRHDALS"
     atgcaacggg agcagatcct gacacaggcg ctgcagcgcc tggagcgaca tggcctggcc        60
     ggcgccacgc tgcccgccct gatcgacagc gaaatgctgt ccctcgatca ggcacgccgc       120
     tactggccag acagcgaggc cctgctgtac gactgcctgc gttttcacag ccagcagatc       180
     gatacctggc gccgacagct cctgctgaat gataccctga gccacgatga caaaattctg       240
     gcccgctatt cggtgctggc cgaacatgtc gagcaggggc gctttcccgg ctgcctgttt       300
     atttcggcct gtatccagta ccctgttacc gaccacccga tccatcagct ggcgtcccga       360
     caaaagcagg cttcgtttga ttttacactg cagctgctgc aggagagtga gattgacgat       420
     gcctcactgg ttgcacatca gatggagctg gtacaggaag gatgtctgaa ccgactgctg       480
     gtcagccgcc gccgtgaaga tgtcgatatc gcactgcatc tggcgcaaga tatcctgcat       540
     atcgcccact gccgacggca cgacgccttg agctaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page