(data stored in ACNUC7421 zone)

EMBL: CP001600.PE344

CP001600.PE344       Location/Qualifiers
FT   CDS_pept        complement(381965..383692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0374"
FT                   /product="thiol:disulfide interchange protein DsbD,
FT                   putative"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67615"
FT                   /db_xref="GOA:C5BDJ9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDJ9"
FT                   /protein_id="ACR67615.1"
FT                   /translation="MAQRIFALIALFITTLLPAQASLFGGQPRFVPVNQAFAFDFQQRG
FT                   ESLTLRWQIQPGYYLYRQQIRITPHQAQLGHWQLPPGIPHHDEFQGETAIFRDGLSLTL
FT                   PLLSAAAGGEVSVTYQGCAAAGFCYPPETRRIPLKAITAAVGVLPPPGTAAMATANTEH
FT                   APTLPFPALWALLIGIGIAFTPCVLPMYPLISALILGQKQRHGWGHTALLALVYVQGMA
FT                   ITYTVLGMVVAAAGLRFQAAFQHPYVLIGLSLLFILLALSMFGAFTLQLPASLQTRLTL
FT                   WSNRQRSGSLLGVFVMGALAGLICSPCTTAPLSAILLYIAQNGNLWVGGGTLYLYALGM
FT                   GIPLIAVTLFGNRLLPRSGPWMQHVKEGFGFVILALPVFLLERILGDAWGARLWSLLGI
FT                   TFFLWGFSLSLHARRRGTRLWQILLLGAALICARPLQDWIFDETPRASIGVSAPLAFQP
FT                   IDSPQQLTQALAQAKARRQPVMLDFYADWCTACKEFEKYTFSNDAVRSQLAGTLLLQAN
FT                   VTANTEQHAQLLQQLNVLGLPSILFFTPDGQPLDDARVTGFMDAKRFLAHLQQLPYAQ"
     atggctcaac gcatctttgc gctgattgcg ctgtttatta ctaccctgct gcccgcccag        60
     gcctccctgt tcggcgggca gcctcgcttt gtaccggtca atcaggcctt tgcctttgac       120
     tttcagcaac ggggggagag tctgacgctg cgctggcaga tccagcctgg ctattacctc       180
     tatcgtcaac agatccggat tacgccccat caggctcagt taggtcattg gcagctgccg       240
     ccggggatcc ctcatcacga cgagtttcag ggggaaaccg ccatcttccg cgatggactg       300
     agcctgacac tgcctctgct cagcgccgcg gcggggggcg aggtcagcgt cacctaccag       360
     ggctgcgccg ccgcgggctt ctgctatccg ccggagacgc ggcgcattcc cctcaaggcg       420
     atcaccgcgg ccgtcggggt cttaccgccg cccggcacgg cggctatggc gacagcgaac       480
     acagagcacg cgccaacgct gccctttcct gccctgtggg cactgctgat cggtatcggc       540
     attgccttta ccccctgtgt cctgccgatg tacccactga tatcggccct gattctgggc       600
     cagaagcaac gtcacggctg gggacatacc gccctgctgg cgttggtcta tgtacagggg       660
     atggccatta cctacaccgt gctgggcatg gtggtggccg ctgccgggct gcgcttccag       720
     gccgcttttc agcaccccta cgtactgatc ggcctctcgc tgctgtttat cctgctggcg       780
     ctctccatgt tcggggcgtt caccctgcag ctgcccgctt cgctgcaaac ccggctgacg       840
     ctatggagca accgccagcg cagcggttcg ctgctgggcg tcttcgtaat gggcgccctc       900
     gcaggcctga tctgctctcc ctgcaccacc gcacccctca gcgccattct gctgtatatc       960
     gctcagaacg gtaacctgtg ggtcggagga gggacactct atctctacgc gctggggatg      1020
     gggatcccgc tgatcgcggt cacgctgttt ggtaaccggc tgctaccgcg cagcggaccg      1080
     tggatgcagc atgtaaaaga gggatttggc tttgtgatcc tggcgctgcc ggtatttctg      1140
     ctggagcgta tactgggcga cgcctggggc gcacggctgt ggagtcttct tggcatcacc      1200
     ttcttcctgt ggggattcag cctctccctg cacgcacgcc gccgcggtac ccgcctttgg      1260
     cagatcctgc tgctgggtgc cgcgctgatc tgcgcccgcc cactacagga ttggatcttc      1320
     gacgaaacgc cacgcgccag catcggcgtc agtgcccccc tggcgttcca gcctatcgac      1380
     tccccacagc agctaactca ggcgctggcg caggccaagg cccgcaggca gcctgtgatg      1440
     ctggacttct atgccgactg gtgcactgcc tgcaaagaat ttgagaaata caccttcagc      1500
     aatgatgctg tgcgtagcca gctggcgggc accctgctat tacaggcaaa cgtgaccgcc      1560
     aatacagagc agcacgccca gctactgcag cagcttaacg tactggggct gccatcgatc      1620
     ctgtttttca ctcccgatgg acagccgtta gacgacgctc gcgtcaccgg ttttatggac      1680
     gccaaacgtt ttctggcgca cctgcaacag ctgccatatg cacagtga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page