(data stored in ACNUC7421 zone)

EMBL: CP001600.PE345

CP001600.PE345       Location/Qualifiers
FT   CDS_pept        complement(383668..383889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0375"
FT                   /product="divalent cation tolerance protein, CutA1 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67616"
FT                   /db_xref="GOA:C5BDK0"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK0"
FT                   /protein_id="ACR67616.1"
FT                   /translation="MTLIPGATSLYCWEGKIEQEYEVQMIIKSERRHQQALLAYLKHQH
FT                   PYQTPELLVIPVQAGDQDYLSWLNASLR"
     gtgaccctta ttcccggcgc cacctccctc tactgctggg aagggaagat tgagcaggag        60
     tatgaggtgc agatgatcat caaaagcgaa cggcgccatc agcaggcgct gctcgcctat       120
     ctaaaacatc agcatcctta tcagacgcca gagctactgg tcattccggt gcaggcagga       180
     gatcaagact acctatcatg gctcaacgca tctttgcgct ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page