(data stored in ACNUC7421 zone)

EMBL: CP001600.PE348

CP001600.PE348       Location/Qualifiers
FT   CDS_pept        387391..387867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0378"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67619"
FT                   /db_xref="GOA:C5BDK3"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK3"
FT                   /protein_id="ACR67619.1"
FT                   /translation="MRWLPFILIFFYVYIEISIFIKVAAVLGVALTLLLVILTSCLGAS
FT                   LVRNQGMKTLMQMQQKLAMGESPAAEMIKSVSLVMAGLLLLLPGFCTDLLGLLLMLPLV
FT                   QKRLALKLLPYFRIYRSSGPGDGGGFGGGPGGGGHTFDGEFERKDDDRQRLDNK"
     ttgcgctggt tgccctttat cctgatattt ttttatgtct atattgaaat atcgattttt        60
     atcaaagtcg ctgccgtttt aggcgttgcg ttgacgctgc tgctggtgat cttgacctcc       120
     tgtctcggcg catcgctggt gcgtaatcag ggaatgaaga cgttgatgca gatgcagcag       180
     aagctggcga tgggggagag tcctgccgca gagatgatta aaagcgtatc gctggtgatg       240
     gcgggtctgc tgctgctgct gccggggttc tgtacggatc tcctcggtct gttgctgatg       300
     ctgccgttgg tacagaagcg cctggcgctg aaactgcttc cttacttccg tatttaccgc       360
     agcagtggcc cgggcgacgg cggtggcttc ggtggtgggc ctggcggcgg cggtcatacc       420
     tttgacggtg agtttgagcg caaggatgac gatcgtcagc gtctggataa taaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page