(data stored in ACNUC7421 zone)

EMBL: CP001600.PE35

CP001600.PE35        Location/Qualifiers
FT   CDS_pept        33024..33146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0038"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67298"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B7"
FT                   /protein_id="ACR67298.1"
FT                   /translation="MSLTFGLGIILSLITAKRFVRHVHKAFPAMQNRFNPSFCV"
     gtgtcactga ctttcggcct tgggattatt ctgtcgctga ttaccgcaaa acggtttgtc        60
     agacatgtgc acaaggcatt tccagcgatg caaaaccgct ttaatccatc attctgcgta       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page