(data stored in ACNUC7421 zone)

EMBL: CP001600.PE351

CP001600.PE351       Location/Qualifiers
FT   CDS_pept        390331..390678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0381"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67622"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK6"
FT                   /protein_id="ACR67622.1"
FT                   /translation="MRIKGLLGLAAIMLLAGCSTMTQLSSSGQQVKFTDAKPGTECQLL
FT                   GEAVGTQSNWLSGQGGETSSMRAAANDLRNKAAAMGGNVVYGAVSPSESFWSSFAPLDS
FT                   KMSGQVYKCPN"
     atgcgaatta aagggttact ggggctggca gccatcatgc tgctggcagg gtgcagtacc        60
     atgactcagc tgtcttcctc cggccagcag gtgaagttta ccgatgcgaa gccgggcacc       120
     gaatgtcaac tgctgggcga agcggtgggg acccagagca actggctgtc aggtcagggc       180
     ggtgaaacca gctctatgcg cgctgccgct aacgatctgc gcaataaggc tgccgcaatg       240
     ggtggtaacg tggtctatgg cgctgtcagc ccgagtgaaa gcttctggtc cagctttgct       300
     ccgttggaca gcaagatgag cggacaggtt tataaatgcc cgaactga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page