(data stored in ACNUC7421 zone)

EMBL: CP001600.PE352

CP001600.PE352       Location/Qualifiers
FT   CDS_pept        complement(390762..391457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0382"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67623"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK7"
FT                   /protein_id="ACR67623.1"
FT                   /translation="MNNRDEFLATIARQLGREVRHIPQPRPQPINDYAQTRLTGLSVQQ
FT                   RCDAFIDVASNVMLAHCERCSEADAAQAALHLCQRYGQTPTIVSGDGRLAQLGITETLV
FT                   RECPATVWDPALGAENLRMAEQAKVGVVYAEYGLAESGGVVLFSSALHGRALSLLPESS
FT                   IFVLRKSTILPRVAQLASLLHQRAQRGGRMPSCINLIGGPSSTADIELIKVIGVHGPVN
FT                   AAYLIVEDC"
     atgaacaatc gcgatgaatt tctggccaca atcgcccgcc agctggggcg cgaagttcgc        60
     catatcccac agcctcgccc ccagcccatc aatgactatg cccaaacccg cctgaccggg       120
     ctcagcgtac agcagcgctg cgacgccttt atcgacgtcg ccagcaatgt gatgctggcg       180
     cactgtgagc gctgcagcga agccgatgcg gcccaagcgg cgctgcatct atgtcagcgc       240
     tatggccaga cgccgaccat cgtcagcggg gatggccgtc tggcgcagtt ggggatcacc       300
     gaaacactgg tgagggagtg cccggcgacg gtatgggatc cggcgctcgg cgcagagaat       360
     ctgcgcatgg cagagcaggc caaggttggc gtagtctacg ccgaatatgg actggccgaa       420
     tccggcggcg tggtgctgtt ctcctcggcg ttgcacgggc gcgctctgag cctgctgccg       480
     gagtcctcca tctttgtgct gcgtaagagc accattctac cgcgggtggc acagctggcc       540
     agcctgctgc accagcgcgc gcagcgggga gggcggatgc catcctgcat caacctgatc       600
     ggggggccca gttcgaccgc ggatatcgag ctgattaagg tcatcggggt gcacggaccg       660
     gtaaacgccg cctatctgat cgttgaggac tgctaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page