(data stored in ACNUC7421 zone)

EMBL: CP001600.PE354

CP001600.PE354       Location/Qualifiers
FT   CDS_pept        complement(392889..393608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0384"
FT                   /product="Cysteine-rich domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67625"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDK9"
FT                   /protein_id="ACR67625.1"
FT                   /translation="MNVNFFVTCLGDALKSRMARDSVLLLEQLGCTVHFPEKQGCCSQP
FT                   AINGGYVEDAIPGMKTLIRALEENDDPIISPAGSCTYAVKSYPSYLSDEPGWALRAERV
FT                   ANRMVDLTSFIVNSLGVQDVGAHLPGRAVYHPSCSLLRKMKVRDEPLTLLSHVRGLELL
FT                   PFPAAETCCGFGGTFSIKMAEISGEMVKEKVSHMMEAQPEYLIGADISCLINIGGRLQR
FT                   EGLPVKVMHIAEVLMSR"
     gtgaacgtca actttttcgt cacctgtctt ggagacgccc tgaagtcgcg catggcgcgc        60
     gatagcgtac tgctgctgga gcagctgggc tgtacggtcc actttccgga aaagcaaggc       120
     tgctgcagcc agcctgccat caacggcggc tacgttgagg atgccattcc gggcatgaag       180
     accctgatcc gcgcgctgga ggaaaacgac gacccgatca tctcgccggc gggctcctgc       240
     acctatgcgg tcaagagcta tcccagctac ctgagcgacg agcccgggtg ggcgctacgc       300
     gccgagcgcg tcgccaaccg gatggtcgac ctcacctcct ttatcgtcaa ctccctcggc       360
     gttcaggacg tgggcgccca cctgccaggg cgggcggtct accacccctc ctgcagcctg       420
     ctgcgcaaaa tgaaggtccg cgatgagccc ctgacgctgc tgagccatgt ccgggggctg       480
     gagctgctgc cgttccccgc cgccgagacc tgctgcggct ttggcggcac cttctccata       540
     aaaatggccg agatctccgg agagatggtg aaagagaagg tcagtcatat gatggaggcc       600
     cagccggagt atctgatcgg tgccgatatc agctgcctga tcaacattgg cggccgcctg       660
     cagcgcgaag ggctaccggt caaggtgatg cacatcgccg aagtgctgat gagccgttaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page