(data stored in ACNUC7421 zone)

EMBL: CP001600.PE356

CP001600.PE356       Location/Qualifiers
FT   CDS_pept        complement(395450..396478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0386"
FT                   /product="KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67627"
FT                   /db_xref="GOA:C5BDL1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL1"
FT                   /protein_id="ACR67627.1"
FT                   /translation="MAHIITQKGQPREDWLQQLADVVTDPADLLAQLGLSDHPQWLAGC
FT                   EARRLFPLRVPHAFISRIRRGDPNDPLLRQVMSDAAEFIETPGFSTDPLAEQHSVVPGL
FT                   LHKYQNRALLLVKGSCAVNCRYCFRRHFPYQENQGTRANWQRAVAYLCEHPELDEIIFS
FT                   GGDPLMAKDHELDWLFTQLEQLPHLRRLRIHSRLPVVIPARVTDALCQRMADSRLQMIL
FT                   VTHINHANEIDEALSEAMERLKQAGVTLLNQSVLLRGINDNADTLAALSNALFEAGILP
FT                   YYLHVLDKVQGGAHFMVPDDEARRLMNGLLSRVSGYLVPRLTREIGGEPSKTPLDLHLR
FT                   QQ"
     atggcacata ttataaccca aaaagggcag ccgagagaag attggctgca acaacttgcc        60
     gacgttgtca ccgaccccgc cgacttactg gcccagctgg gcctttctga ccatccacag       120
     tggctggcag gctgcgaggc ccgtcgcctg tttcctctgc gggtaccaca cgccttcatc       180
     agccggatcc gccgtggcga tcctaacgat cccctgctgc gccaggtgat gagtgacgcc       240
     gccgagttta ttgaaacgcc cggtttctcc accgatccgc tggcagagca gcacagcgtc       300
     gttcccggtc tgctgcacaa ataccaaaac cgcgcgctgc tgttggtcaa gggcagctgc       360
     gccgtcaact gccgctactg cttccgccgc cactttccct atcaagaaaa tcagggaacc       420
     cgcgccaact ggcaacgggc ggtggcgtat ctgtgcgaac acccagagct ggatgagatc       480
     attttctccg gcggcgatcc tctgatggcc aaagatcacg agctggactg gctgttcacc       540
     cagctggagc agctgccgca cctccggcgg ctgcgtatcc atagccgcct gccggtggtg       600
     atcccggcgc gcgtgaccga tgcgctgtgc caacgcatgg cggactcccg tctgcagatg       660
     atactggtca cccatattaa ccacgccaac gaaattgatg aagcactgag cgaggccatg       720
     gagcgactga agcaggccgg cgtgactctg ctgaatcaga gcgtgctgct gcgtggcatc       780
     aacgataacg ccgatacgct ggcggccctg agcaacgcgc tgtttgaggc cggtattctc       840
     ccctactatc tgcatgttct ggataaggtg cagggtggtg cccactttat ggtgccggat       900
     gatgaggcac gtcgcctgat gaacgggctg ctgtcccggg tctccggtta tctggtaccg       960
     cgtctaaccc gcgaaatcgg cggtgaaccg agcaaaaccc cgctggatct gcatctgcgc      1020
     cagcagtag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page