(data stored in ACNUC7421 zone)

EMBL: CP001600.PE358

CP001600.PE358       Location/Qualifiers
FT   CDS_pept        397298..397600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0388"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67629"
FT                   /db_xref="GOA:C5BDL3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL3"
FT                   /protein_id="ACR67629.1"
FT                   /translation="MLIAGLLEVVWAISLKYSHGFTRLWPSVVTLLAMVASVLLLAHAM
FT                   KTLPAGTAYAVWTGIGAVGAAIMGIVLQGESASPLRLLSLGLIICGILGLKFSNA"
     ttgctgatag ccggcctgct cgaagtggtc tgggccatca gtttaaagta ttcccacgga        60
     tttactcgcc tgtggcccag tgtcgttacg ctgctggcga tggtcgctag cgtactgctg       120
     ctggcccatg cgatgaaaac cttgcctgcc ggtaccgcct atgctgtctg gaccggcatc       180
     ggtgccgtcg gcgccgccat catgggaatt gtgctgcagg gtgagtcggc cagccccctg       240
     cgtctgctga gcctggggct tattatctgc gggatactgg gacttaagtt tagcaacgcc       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page