(data stored in ACNUC7421 zone)

EMBL: CP001600.PE359

CP001600.PE359       Location/Qualifiers
FT   CDS_pept        complement(397671..398030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0389"
FT                   /product="fumarate reductase, subunit D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67630"
FT                   /db_xref="GOA:C5BDL4"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDL4"
FT                   /protein_id="ACR67630.1"
FT                   /translation="MMNNKVYKRSDEPVFWGLFGAGGMWGAIFAPAVILIVGILLPLGM
FT                   FPDALTFERALSFSQSIIGRIFWLLMIILPLWCGLHRLHHMMHDLKIHVPASSWVFYGL
FT                   AAILSVVALIGIFTL"
     atgatgaaca ataaagttta caaacgttct gacgagccgg ttttttgggg tctgtttggc        60
     gcaggcggta tgtggggagc tatcttcgcg ccggccgtga tcctgatcgt tggcattctg       120
     ctgccgctgg ggatgttccc ggatgcgctg acctttgagc gcgccctgag cttcagccag       180
     agcatcatcg gccgtatctt ctggctgctg atgatcattc tgccgctgtg gtgtggtctg       240
     caccgtctgc accacatgat gcacgatctg aagatccacg tgccggcaag cagctgggta       300
     ttctatggtc tggcggccat tctgagcgtt gtggcgctga tcgggatctt taccctgtaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page