(data stored in ACNUC7421 zone)

EMBL: CP001600.PE36

CP001600.PE36        Location/Qualifiers
FT   CDS_pept        complement(33124..33384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67297"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9B8"
FT                   /protein_id="ACR67297.1"
FT                   /translation="MSGIPAPENILAAISIQQTDFFNNQILFGTVFHEKGDAKRNPPTR
FT                   NTAKNWISPAPHVFVPDHRQRHRLAERRGTLRYRIIRRMMD"
     atgagtggta tacctgcccc tgaaaatatt ttggcggcga tctcaatcca acaaactgac        60
     ttttttaata atcagattct gtttggtacg gtattccatg aaaagggtga tgcaaaacgc       120
     aaccctccca ccagaaatac agccaaaaac tggatatcac cagcgcccca tgtatttgtt       180
     ccagatcacc gccaacgcca cagactagcc gaacggcgcg gtacattgcg ttatcgcatc       240
     atacgcagaa tgatggatta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page