(data stored in ACNUC7421 zone)

EMBL: CP001600.PE360

CP001600.PE360       Location/Qualifiers
FT   CDS_pept        complement(398044..398442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0390"
FT                   /product="fumarate reductase, subunit C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67631"
FT                   /db_xref="GOA:C5BDL5"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL5"
FT                   /protein_id="ACR67631.1"
FT                   /translation="MTTSTKRKPYVRGMSSNWWHKLGFYKFYMLRESSALENVWFSIVL
FT                   IYGVFSLKDGAAGWESFVAFLQNPLVLVLNIISLLLAVLHTKTWFELAPKAANIVVNDE
FT                   KMGPAPIIKALWVVTIVVTVVVLGLALL"
     atgacgactt caaccaaacg caaaccctat gtgcggggta tgtcatccaa ctggtggcac        60
     aagctgggtt tctataagtt ctacatgctg cgcgaaagtt cagcgctgga aaacgtctgg       120
     ttcagcattg tgctgatcta tggcgtattc tcgctgaaag acggtgccgc aggctgggaa       180
     agctttgttg cgttcctgca aaacccgctg gtactggtcc tcaatatcat ctccctgctg       240
     ctggccgtgc tgcataccaa gacctggttt gagctggcgc caaaagcggc caacatcgtg       300
     gtaaacgatg agaagatggg cccggcaccg attatcaagg cgctgtgggt tgtcactatc       360
     gtcgttaccg tggtggttct gggcctggcc ctgctgtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page