(data stored in ACNUC7421 zone)

EMBL: CP001600.PE361

CP001600.PE361       Location/Qualifiers
FT   CDS_pept        complement(398459..399193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0391"
FT                   /product="fumarate reductase, iron-sulfur subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67632"
FT                   /db_xref="GOA:C5BDL6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL6"
FT                   /protein_id="ACR67632.1"
FT                   /translation="MAEMKNLKMEVMRYNPEQDAEPRFVTYEVPYDDATSLLDALLYVK
FT                   DNLAPDLSFRWSCRMAICGSCGMMVDNVPKLACKTFLRDYPNGMRVEALANFPVERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEEGTNKQTPAEMEKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPVLNTQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
     atggctgaga tgaaaaacct gaaaatggaa gtcatgcgct acaacccgga acaggatgcc        60
     gagccgcgct ttgtgactta cgaggttccg tatgatgacg caacctccct gctggatgcc       120
     ctgctgtatg tgaaggacaa tctggcgccg gacctctcct tccgctggtc ctgccgcatg       180
     gctatctgcg gctcctgcgg gatgatggtc gataacgtac cgaaactggc ctgtaagacc       240
     ttcctgcgcg actacccgaa cgggatgcgc gttgaggcgc tggccaactt cccggttgag       300
     cgcgatctgg tggtcgatat gacccacttt atcgagagcc tggaagcgat caaaccgtac       360
     gtcatcggca acgatcgcaa accggaagag ggtaccaata agcagacccc ggcggagatg       420
     gagaaatacc atcagttctc cggctgcatc aactgtggcc tgtgctatgc cgcctgcccg       480
     cagtttggtc tgaatccgga gttcatcggc ccggccgcga tcaccctggc tcaccgctac       540
     aacctggaca accgcgacca cggtaagaaa gagcgtatgc cggtactgaa cacccaaaac       600
     ggtgtttgga gctgtacctt cgtcggttat tgctctgaag tctgcccgaa acacgtggat       660
     ccggctgcgg ccatccagca gggcaaggta gaaagtgcca aagatttcat gatcgcaatg       720
     ctgaaaccgc aataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page