(data stored in ACNUC7421 zone)

EMBL: CP001600.PE362

CP001600.PE362       Location/Qualifiers
FT   CDS_pept        complement(399186..400985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0392"
FT                   /product="fumarate reductase, flavoprotein subunit,
FT                   putative"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67633"
FT                   /db_xref="GOA:C5BDL7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL7"
FT                   /protein_id="ACR67633.2"
FT                   /translation="MQTFNADLAIVGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQAHDSFDFHFHDTVAGGDWLCEQDVVDHFVHNCPREMTQLELWGCPW
FT                   SRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGQARGVVAINMMEGTMVQIRANAVILATGGAGRVYRYNTNGGIVTGDGMGMAFKHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTISTPRGDVVYLDLRHLGAKKLHERLPFICELAKAYV
FT                   GVDPVNEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGESALQHLQNVTPTNGTALDAQVKDIEGNLKALVNQEGNENWATLRDEMGT
FT                   SMEEGCGIYRTTDLMQKTVDKLAELKERFKHVKITDTSSVFNTELLYAIELEHGLNVAE
FT                   CMAHSAINRRESRGAHQRLDEGCTERDDVNFLKHTLTYFNESGAPRIEYSDVKITKLPP
FT                   AKRVYGAEAEAQEAKKKEEKANG"
     gtgcaaacct ttaacgcaga ccttgccatc gtcggggctg ggggtgctgg cttacgagca        60
     gcgattgccg ccgccgaggc caaccctcaa ctgaagattg ccttaatctc aaaagtgtac       120
     ccgatgcgca gccacaccgt ggcggcggaa ggcggttccg cggccgtcac tcaggctcat       180
     gactctttcg atttccactt ccacgatacc gttgccggtg gtgactggct gtgtgagcaa       240
     gacgtcgtcg atcacttcgt acataactgt ccgcgcgaaa tgacccaact ggagctgtgg       300
     ggttgcccgt ggagccgtaa acctgacggt tcggtcaacg tacgtcgttt cggtggcatg       360
     aagattgagc gtacctggtt tgccgcagac aagaccggct tccacatgtt gcacacccta       420
     ttccagacct cactgaagta tccgcagatc cagcgtttcg atgagcactt cgtgctggat       480
     atcctggtgg atgacggtca ggcccgcggc gtcgtcgcca tcaatatgat ggaaggcacc       540
     atggtgcaga tccgcgccaa cgccgttatc ctggcaaccg gcggcgcagg ccgtgtatac       600
     cgttacaata ccaacggcgg catcgtcacc ggcgacggga tgggcatggc cttcaaacac       660
     ggtattccgc tgcgtgacat ggagttcgtt caatatcacc cgaccggtct gccgggctca       720
     ggcatcctga tgactgaagg ctgccgcggc gaaggcggga ttctggtcaa caaggacggc       780
     taccgttacc tgcaggatta tggcctcggg ccggaaacgc cgctgggcga gccgaagaac       840
     aaatacatgg agctggggcc gcgtgacaaa gtgtcccagg ctttctggca cgaatggcgc       900
     gcaggccgca ctatttccac accgcgcggc gacgtcgtgt atctggacct gcgtcatctc       960
     ggcgccaaga agctgcacga gcgcctgccg ttcatctgtg aactggccaa ggcctacgtc      1020
     ggtgtcgatc cggtcaatga gccgatcccg gtacgaccga ccgcacacta caccatgggc      1080
     ggtatcgaaa ccgatcagaa ctgtgaaacc cgcattaagg gtctgtttgc cgtcggcgaa      1140
     tgctcctctg tcggcctgca cggcgccaac cgcctgggct ccaactccct ggctgaactg      1200
     gtggtctttg gccgcgtcgc tggcgaaagc gccctgcagc atctgcagaa tgtcaccccg      1260
     acgaacggca cggcgctgga cgcgcaggtg aaagacatcg agggcaacct caaagcgctg      1320
     gttaaccagg aaggcaacga aaactgggcg accctgcgcg atgaaatggg cacctccatg      1380
     gaagagggct gcggtatcta ccgtaccacc gatctgatgc agaagacggt cgacaaactg      1440
     gctgagctga aagagcgctt caagcacgtc aagatcaccg atacctccag cgtattcaac      1500
     accgagctgc tgtatgccat cgagctggag cacggtctga acgttgccga gtgtatggca      1560
     cattccgcca ttaaccgtcg tgaatcccgc ggtgctcacc agcgcctgga tgaaggctgc      1620
     accgagcgtg atgacgtaaa cttcctgaag catacgctga cctacttcaa tgaaagcggc      1680
     gcaccgcgca ttgagtacag cgatgtgaag atcaccaagc tgccgccggc caaacgtgta      1740
     tacggtgccg aagcagaagc tcaggaagcc aagaagaaag aggaaaaagc gaatggctga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page