(data stored in ACNUC7421 zone)

EMBL: CP001600.PE363

CP001600.PE363       Location/Qualifiers
FT   CDS_pept        complement(401188..401301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67634"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDL8"
FT                   /protein_id="ACR67634.1"
FT                   /translation="MNLKTIYTILKSKQNILKIEYNGRNILKITFYYFFPL"
     atgaatctga aaactattta cactattcta aaaagcaaac aaaacatatt aaaaatagaa        60
     tataacggca gaaacatcct taagatcaca ttttactatt ttttcccgct ctaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page