(data stored in ACNUC7421 zone)

EMBL: CP001600.PE364

CP001600.PE364       Location/Qualifiers
FT   CDS_pept        401458..402435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0394"
FT                   /product="lysyl-tRNA synthetase-like protein GenX"
FT                   /note="lysyl-tRNA synthetase homolog GenX"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67635"
FT                   /db_xref="GOA:C5BDL9"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDL9"
FT                   /protein_id="ACR67635.1"
FT                   /translation="MSDMASWQPSAPVANLLKRASILSTIRRFFSDRGVLEVDTPSMSQ
FT                   ATVTDVHLVPFQTHFVGPGVAQGMMLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECESAETLSYQQAFIRHLDVDPLS
FT                   ADKTQLREVAAKLDLSNVADNEEDRDTLLQLLFAFGVEPHIGKERPVFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYRGVELANGFHELTDAAEQRQRFEQDNRKRAAAGLPQQPIDE
FT                   HLLAALEHGMPDSSGVALGVDRLIMLALSAERLSEVIAFSVDRA"
     atgagcgata tggcaagctg gcagcccagt gcacctgtgg ctaatttgtt gaaacgtgcc        60
     agcatcctgt ccaccatccg gcggtttttc tcagaccgcg gcgtgctgga ggtcgacacc       120
     ccgtcgatga gccaggccac ggtaacggat gttcacctgg ttccctttca gacccacttt       180
     gtcggtcccg gggtagcaca ggggatgatg ctatatctga tgaccagccc ggagtatcat       240
     atgaagcggc tgctggccgc cggcagcggc cccatctatc agctgtgtcg cagtttccgc       300
     aatgaagagt ctgggcgcta tcacaatccg gaatttacca tgctggaatg gtatcgcccg       360
     cattatgata tgtatcgtct gatgaatgaa gtggacgatt tgttgcaaca ggtgcttgaa       420
     tgcgaaagtg ccgaaacgct ctcttatcag caggctttta ttcgtcatct ggacgttgat       480
     ccgctctctg ccgataaaac tcagctgcgt gaagtggcgg caaaactgga tttaagtaat       540
     gttgctgata atgaggagga tcgcgatacg ctgctgcagc tgttatttgc ctttggcgtt       600
     gagccccata tcggtaaaga acgtccggta tttgtctacc attttccggc cagtcaggca       660
     tcgctggcgc agatcagtac tgaggaccac cgcgtcgcgg agcgctttga ggtgtactac       720
     cgcggcgtag agctggccaa cggtttccat gagctgactg atgcagcgga gcagcgccag       780
     cgctttgaac aggataatcg caagcgggcg gcggcgggac tgccgcagca gccgatcgac       840
     gagcatctgc tggcggcgct ggagcacgga atgccggaca gctccggggt cgcactgggc       900
     gtcgatcgtc tgatcatgtt ggcgctgtca gccgagcgtc tcagcgaggt gatcgccttc       960
     tccgtcgatc gcgcctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page