(data stored in ACNUC7421 zone)

EMBL: CP001600.PE365

CP001600.PE365       Location/Qualifiers
FT   CDS_pept        complement(402438..402749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0395"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67636"
FT                   /db_xref="GOA:C5BDM0"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM0"
FT                   /protein_id="ACR67636.1"
FT                   /translation="MRYYRTSIWLIAPLLMAVVIFNNLANRSFTSTLGCACFIMMCPTL
FT                   LLLATSLRRAGTPLYLNRADSGENQLNHLLWGGLLYALLTEYAGHKKPAPGAGLGGNR"
     atgcgctatt accgcacgtc tatctggctt atcgctccgc tgctgatggc cgtggtgatc        60
     ttcaacaatc tggccaatcg cagctttacc tctacccttg ggtgcgcctg cttcatcatg       120
     atgtgcccga ccctgctgtt gctggccacc agcctgcgcc gcgccggtac tccgctatat       180
     ctcaatcgcg ctgactccgg tgaaaatcag cttaaccacc tgctgtgggg agggctgctg       240
     tacgctctgc tgacggagta tgccgggcat aaaaaacccg cgccgggcgc gggtctggga       300
     ggtaatcgtt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page