(data stored in ACNUC7421 zone)

EMBL: CP001600.PE368

CP001600.PE368       Location/Qualifiers
FT   CDS_pept        complement(404571..405614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0398"
FT                   /product="ribosome small subunit-dependent GTPase A,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67639"
FT                   /db_xref="GOA:C5BDM3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM3"
FT                   /protein_id="ACR67639.2"
FT                   /translation="MSKKKLSHGQQRRVHTNHQRRLQQTDNSAEMDDSLFGDAQDGIVV
FT                   SRFGKHADVEAADGTQQRCNIRRTLPSLVTGDRVVWRAALQAGSKGIIEAVHPRSSVLT
FT                   RPDYYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLCVEPLIVLNKVDLLDE
FT                   EGREFVEQAMEIYRHIGYRVVLVSSHNGEGIVQLQDRLTQRISIFAGQSGVGKSSLLNA
FT                   LLPTLESQIEVGAVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLDAEQIT
FT                   QGFIEFRDYLGGCKFRDCKHGNDPGCALREAVERGDIAETRFDNYHRILEGMAQVKLRK
FT                   NFGNGDS"
     ttgagtaaga aaaaactatc gcacggccag cagcgacggg tgcataccaa tcaccagcgt        60
     cgtctgcagc agacggacaa tagcgcagag atggacgaca gcctgttcgg tgacgcccag       120
     gacgggattg tcgtcagccg tttcggcaaa catgccgacg ttgaggccgc cgatggcact       180
     cagcagcgct gcaacatccg ccgtaccctg ccatcgctgg tgaccggcga tcgggtggtc       240
     tggcgcgccg cgctgcaggc tggcagcaaa gggatcatcg aggccgttca tccgcgcagc       300
     tccgtcctga cgcgtccgga ctactacgat ggagtgaaac ccatcgccgc caatatcgac       360
     cagatcgtca tcgtctcggc tatcctgccg gagctgtcgc tgaacatcat cgatcgctat       420
     ctggtcgcct gtgaaaccct ctgcgtcgag ccgctgatcg tgctgaacaa ggtcgatctg       480
     ctggatgaag aggggcgcga gtttgtcgaa caggcgatgg agatctatcg tcacattggc       540
     taccgggtag tgctggtctc cagccacaac ggcgaaggca tagtgcagct gcaggatcgg       600
     ctaacccagc gcatcagcat cttcgccggt cagtccggcg tgggtaaatc cagcctgctc       660
     aacgcgttgc tgccgacgct ggagagtcag atcgaggtcg gcgccgtctc cgataactcc       720
     ggtctgggcc agcacaccac caccgcggcc cggctgtatc actttccgca cggcggtgac       780
     gtgatcgact cgcccggcgt ccgtgaattt ggcctgtggc atctggacgc agagcagata       840
     acccaaggat tcattgagtt tcgtgactac ctgggcggct gcaagttccg cgactgtaaa       900
     cacggcaacg atccgggctg cgccctgcga gaggcggtag agcgcggcga tatcgcagaa       960
     acgcgttttg acaactatca tcgtattctt gaggggatgg cgcaggttaa actgcgcaag      1020
     aacttcggca acggcgatag ctaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page